KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0554400-01
Entry
Os05t0554400-01   CDS       T02163                                 

Gene name
Os05g0554400
Definition
(RAP-DB) Phosphatidyl serine synthase family protein.
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00564  Glycerophospholipid metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os05t0554400-01 (Os05g0554400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     Os05t0554400-01 (Os05g0554400)
SSDB
Motif
Pfam: PSS Oxidored_q2
Other DBs
RAP-DB: Os05t0554400-01
Position
chr05:join(27553179..27553333,27554049..27554114,27554295..27554354,27554749..27554839,27555217..27555271,27555361..27555440,27555554..27555667,27555750..27555834,27556361..27556452,27556996..27557249,27557346..27557434,27557852..27557979)
AA seq 422 aa
MEAKQRTRHRDGEERRLVAAADGGAEEYDPWTAWLYKPHTISVLLVGACLLIWASGALDP
EGASYHSSATSIKRGVWAMIAVFLAYCTLQAPSTILIRPHPAVWRLVHGLAVVYLVALAF
LLFQNRDDARQFMKHLYPDLGVELPERSYGADCRLYVPENPKNKFINIYTLFDEFVVAHI
LGWWGKAVMIRNQLLLWVLSIGFELMELTFRHMLPNFNECWWDSIILDILICNWFGIWAG
MHTVRYFDGKTYEWVGLSRQPSIMGKVKRSLSQFTPAQWDKDQWYPFMGPLRFVQVLFLC
VVFMTVELNTFFLKFCLWIPPRNPLVVYRLILWWLIAIPTIREYNSYLQNSKPVKKVGAF
CWLSLAICIVELLICMKFGHGLFHDPMPTWLIIFWSSVGVALVVFLLAWSWRNHLKYQRK
RL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggaggcgaagcagaggacgaggcatcgcgacggagaggagaggaggctcgtagcggcg
gcggatggcggcgccgaggagtacgacccatggacggcgtggctctacaagccgcacacc
atctcggtgctcctcgtcggtgcttgccttctaatttgggcaagtggagcgcttgatcca
gagggtgcttcttatcacagtagtgcgacatctattaagaggggtgtctgggctatgatt
gcagtcttccttgcttactgcactctccaagcaccttcaacgatacttattaggccccat
cctgctgtctggcgcctggtgcacggactggctgtcgtttaccttgtcgctctagccttt
cttcttttccagaaccgcgatgatgctcgccagttcatgaaacacctttaccctgatctt
ggagttgaattgccggagagatcttatggagctgactgccgtctgtatgttccggaaaac
cctaaaaacaagttcataaatatttatacattatttgacgaatttgtggttgcccatatt
ttgggttggtggggtaaagccgtaatgatacgaaaccagcttcttctttgggtcctctcg
attggtttcgagctaatggagcttacattcagacatatgttgccaaactttaatgagtgc
tggtgggatagtattattttggatatcttgatctgcaactggtttggtatatgggcgggg
atgcacacagtccgttactttgacggtaaaacatatgagtgggttggactgagccgacag
ccaagcatcatgggcaaggtgaaaagatcactgagccagttcacccctgcacaatgggac
aaggatcaatggtaccctttcatggggccgttgcggttcgttcaagtgttgttcctgtgc
gttgttttcatgacagtggagctcaacacattttttcttaaattttgcctctggattcct
ccaaggaatcctttggttgtgtacagattaatcctatggtggttgattgctattccaacc
atccgtgagtacaactcctacttgcaaaacagcaaaccggtgaagaaggttggggctttt
tgctggctctctctagctatatgcattgtagagcttcttatatgtatgaagtttggacat
gggctgtttcatgatcccatgcctacttggttgatcatcttttggagttcggtgggggta
gcactagtggttttcttgcttgcatggtcttggaggaatcacctgaaatatcagagaaag
cggctataa

DBGET integrated database retrieval system