KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0567400-01Help
Entry
Os05t0567400-01   CDS       T02163                                 

Gene name
Os05g0567400
Definition
(RAP-DB) Ribosomal RNA methyltransferase J domain containing protein.
  KO
K14857  AdoMet-dependent rRNA methyltransferase SPB1 [EC:2.1.1.-]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os05t0567400-01 (Os05g0567400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Os05t0567400-01 (Os05g0567400)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Os05t0567400-01 (Os05g0567400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spb1_C FtsJ DUF3381
Motif
Other DBs
RAP-DB: Os05t0567400-01
Position
chr05:join(28245146..28245619,28245981..28246028,28246110..28246263,28246358..28246406,28246660..28246822,28246921..28246982,28247146..28247329,28247419..28247508,28247879..28248012,28248130..28248262,28248429..28249397)
AA seq 819 aa AA seqDB search
MGKTKGKQRQDKFYHLAKEQGYRSRAAFKLLQLDARFRFLPTARAVLDLCAAPGGWVQVA
VNHAPVGAFVVGVDLVPIRPIRGAHSLTEDITTTKCRAAVRRLMDSNGVAAFDVVLHDGS
PNVGGAWAQEATAQSSLVIDAVRLATMFLAPKGAFITKVFRSQDYNAIMYCLKQLFEKVE
VTKPTASRSTSAEIYIICLRYKAPAKIQPELLDIKHLFSVDPDPKKVRDPLKPDRQKRNR
DGYEEGNTTLRKVGLASDFIWSEGQTPLEFLGSFNAISFDDPASLPIKNHELTTDEIKAL
CEDLYVLDKNSFKHILKWRIRIRKALSSSEVTKKTDDTAVEVNVKDDDQLLQEMEELTSV
IDRKKKREKKRQSKRRAKDKARKATGMQIDATGDNYGDPDLFSISAIKGGKELQAIESAE
LNVEDAQGDSENEDIQTREYSDEEMDSDEEQQRYDAQLEEMLDEAYERYVTKKGGEVKQE
RKRAKRVNTDADEELLEGGEDDGDDVDMDQGSDEEQDQETNPLLLSLDAEKPTKEQMMEQ
WFSQDVFTEAGTGVVEQSDSEDEREQLTRIAKKKADSGKKEKSAKAKHLQQDDFEIVPAE
PVRTEDDSSSSSDESDELDEDLDDDTKAEVLAYARKMLRKKQREQILDDAYNKYMFDDEG
LPKWFAEDEKRHNQPMKPVTKEEVAAMRAQFKEIDARPAKKVAEAKARKKRVAMKKLDKA
RQKADAIADQNDINEQSKRKMIDRIYKKAIPKKPQKEYVVAKKGVQVRAGKGKILVDKRM
KKDKRASKVKGGKGAKGKGKKGGGQKGGMRGKAGRKAQN
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggggaagacgaaggggaagcagcggcaggacaagttctaccacctcgccaaggagcag
gggtaccggagccgcgcggccttcaagctgctccagctcgacgcgcggttccgcttcctg
ccgacggcgcgcgcggtgctcgacctctgcgcggcgcccgggggatgggtccaggtggcc
gtcaaccacgcgcccgtgggggccttcgtcgtcggcgtcgacctcgtccccatccgcccc
atccgcggcgcgcactccctcacggaggacatcaccaccaccaagtgccgcgccgccgtg
cggaggctcatggactccaacggcgtcgccgcgttcgacgtcgtgctccacgacgggtcc
cccaacgtcggtggcgcgtgggcgcaggaggccaccgcgcaatcgtcgctcgtcatcgac
gccgtgcgcctcgccaccatgttcctcgcccccaagggtgccttcatcactaaggttttc
aggtctcaggattacaacgctattatgtactgtcttaaacagttatttgagaaggttgaa
gtcactaaacctactgcaagtcgttctacgtctgcagaaatttatattatctgtctgaga
tataaagctcctgcaaagattcagccagaacttttggatataaagcatttgttcagtgtg
gatccagatcctaaaaaggttagggatcctctcaagccggacagacagaagaggaaccgt
gatggatacgaagaaggaaatacaacattgcgaaaagttggtctggcttcagattttata
tggtctgagggccaaacgcccctagagtttcttggttcttttaatgcaatttcatttgat
gacccagcatctcttcctatcaagaaccatgagcttactacagatgagataaaagctctt
tgtgaggatttgtatgtactggacaaaaacagcttcaagcatatcttgaaatggcggata
cgcatacggaaagcactatcatcttctgaagtcactaaaaaaactgatgatactgcggtg
gaagtcaatgtcaaggatgatgaccaacttctacaggaaatggaagaattgacgagtgtc
attgatagaaagaagaagagagaaaagaagcgtcaatcaaagcgccgtgcaaaggataaa
gcacgcaaagcaacaggaatgcaaatagatgctacaggagataattacggcgatcctgat
ttgttttctataagtgctatcaagggcggaaaagaactccaagctattgaatcggctgag
cttaatgtagaagatgcccaaggagatagtgagaatgaggatattcaaactcgtgaatac
tctgatgaggaaatggattctgacgaagaacagcagaggtatgatgcccaacttgaggaa
atgcttgatgaagcttatgagcgttatgtaactaaaaagggtggtgaagtgaaacaagaa
cgcaagcgtgcaaaacgagtaaatactgatgctgatgaagaattattagagggaggtgaa
gatgacggtgacgatgttgacatggatcaaggttctgatgaagagcaagatcaagagacc
aatccccttttattatccctagatgcagagaaaccaacaaaagagcagatgatggagcag
tggttcagccaggatgtattcacagaagcaggaacaggtgtggttgagcagagtgatagt
gaagatgaaagagagcagctaactaggattgcaaaaaagaaggcggattctggaaagaag
gaaaagtctgctaaagcaaaacacttgcaacaggacgattttgagattgtgccagcagaa
ccagtccgaactgaagatgactcatcttcatcttctgatgagtctgatgaactagatgag
gacctcgacgatgacacaaaagctgaagtactagcctatgcaaggaagatgttgaggaag
aaacagagagagcagatacttgacgacgcttacaacaagtacatgtttgacgacgagggt
ttacctaaatggtttgctgaggatgaaaagaggcataaccagcctatgaagcctgtaaca
aaagaggaggtagctgccatgagggctcagttcaaggagatcgatgctcggccagccaag
aaggtcgctgaggctaaggctcggaagaagcgcgtcgccatgaagaagctggataaggcg
cgccagaaggcagatgccatcgcagatcaaaacgacataaacgagcagtcaaagaggaag
atgatcgacaggatttacaagaaggcgattccaaagaagccccagaaggagtacgttgtc
gcaaagaagggcgttcaggtgagggctggcaaagggaagatactggtggataagcgtatg
aagaaggacaagagggccagcaaagtgaagggtggcaaaggagctaagggcaaggggaag
aagggcggcggccagaaaggcggtatgcgagggaaagctgggaggaaagcccaaaactga

DBGET integrated database retrieval system