KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0573500-00
Entry
Os05t0573500-00   CDS       T02163                                 

Gene name
Os05g0573500, HAP3B, HAP3B_SUBUNIT_OF_CCAAT-BOX_BINDING_COMPLEX
Definition
(RAP-DB) HAP3.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os05t0573500-00 (Os05g0573500)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os05t0573500-00 (Os05g0573500)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C
Other DBs
RAP-DB: Os05t0573500-00
Oryzabase: 3124
Position
chr05:join(28572646..28572848,28573005..28573134,28574014..28574019,28574100..28574177,28574861..28574875)
AA seq 143 aa
MSEGFDGTENGGGGGGGGVGKEQDRFLPIANIGRIMRRAVPENGKIAKDSKESVQECVSE
FISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLRLYRETEGDTKGSR
ASELPVKKDVVLNGDPGSSFEGM
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtcggaggggttcgacgggacggagaacggcggcggcggcggcggaggcggagtaggg
aaggagcaggaccggttcctgccgatcgccaacatcggccgcatcatgcgccgggccgtg
ccggagaacggcaagatcgccaaggactccaaggagtccgtccaggagtgcgtctccgag
ttcatcagcttcatcaccagcgaagcaagcgacaagtgcctcaaggagaagcgcaagacc
atcaatggggacgacctgatctggtcaatgggcacgctcggattcgaggactatgtcgag
cctctcaagctctacctcaggctctaccgggagacggagggtgacacaaagggttcaaga
gcttctgaactgccagtaaagaaagatgttgtacttaatggagatcctggatcatcgttt
gaaggcatgtag

DBGET integrated database retrieval system