KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0576800-01
Entry
Os05t0576800-01   CDS       T02163                                 

Gene name
Os05g0576800
Definition
(RAP-DB) Similar to Blast and wounding induced mitogen-activated protein kinase.
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    Os05t0576800-01 (Os05g0576800)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dosa01001]
    Os05t0576800-01 (Os05g0576800)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Os05t0576800-01 (Os05g0576800)
Protein kinases [BR:dosa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Os05t0576800-01 (Os05g0576800)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH
Other DBs
RAP-DB: Os05t0576800-01
Position
chr05:join(28721071..28721343,28722259..28722658,28722742..28722869,28722959..28723018,28723191..28723340,28723712..28723867,28723974..28724111,28724200..28724273,28724498..28724599,28725741..28725930,28726079..28726156)
AA seq 582 aa
MGGRARSILRWLRHHRSRRVSSSSFHLTTTGDDTVKDLHDPRREDAEGDGWEEVHEGPES
DPEEYIALVSEDAGTHLPVRTEPRRMDPSKKEPDFFTEYGEANRYKVSEVIGKGSYGVVA
AAVDTQTGERVAIKKINDVFDHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFR
DIYVIFELMESDLHQVIKANDDLTPEHHQFFLYQLLRGMKYIHAASVFHRDLKPKNILAN
ADCKLKVCDFGLARVSFNDTPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCI
FAELLTGKPLFPGKNVVHQLDLMTDLLGTPSAESLAKIRNEKARRYLSNMRKKPRVPFTK
KFPGVDPMALHLLERLLAFDPKDRPSAEEALTDPYFNGLANSEREPIAQPISKLEFEFEK
RKLAKDDVRELIYREILEYHPHMLQEYLRGGDQMSFMYPSGVDRFKRQFAHLEEGVSKGE
KSSPQLRQNASLPRERAIGNKHGDDEYHAKLNVGEKPCHASVTDGISKPLMSARSLLKSE
SISASKCIGEKPKQDRDQEDSLTESMDETADEVSEKVAQLKT
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgggcggccgcgcccgctccatcctacgctggctccgtcaccaccgctcccgccgcgtc
tcctcctcttccttccatctgaccaccaccggtgacgacaccgtcaaggatctccacgac
ccgcggcgagaggacgcggagggcgacgggtgggaggaggtccacgagggccccgagtcc
gaccccgaggagtacattgcgttggtgtcggaggacgcgggcacgcacctgccggtgcgc
acggagccgcgacgcatggatccgagcaagaaggaacctgacttcttcactgaatatggt
gaagcaaaccggtataaagtcagtgaagtcattggcaaagggagttatggtgttgtggct
gccgctgtcgacacccagaccggcgagcgagtggcgatcaagaagatcaatgatgttttc
gatcatgtctctgatgccacccgcatccttagggagattaagttgctccggttgctgcgt
cacccagacatagttgagatcaagcacataatgcttcctccttcaaggagggaattcagg
gacatttatgtaatctttgagctaatggagtcagatctccatcaggtaataaaagcaaat
gatgatctcacaccagagcatcaccagtttttcttgtatcagctgctccggggaatgaag
tacattcatgcagcaagtgttttccatcgggatcttaagcccaagaatattctagccaat
gctgattgcaagctgaaggtttgcgatttcggccttgcccgagtgtcatttaacgatacc
ccatcagccatattctggacggattatgtggcaactagatggtatcgtgccccagagttg
tgtggctcctttttttcaaagtacacccctgcaattgatatttggagtgtaggatgtata
tttgcagagctgcttacaggaaagccactctttccagggaaaaatgttgtgcatcaattg
gatctcatgactgatctacttggcactccttcagcagaatcccttgctaagatacggaat
gagaaagctcgacgatacctgagcaacatgaggaaaaagcctcgggttccttttactaaa
aaatttccaggtgtggatcctatggctctccatttgcttgaacgccttcttgcttttgat
cccaaagatcgtccaagtgcagaagaggccctgacagacccctactttaatgggctagca
aactctgaacgcgaaccaatagcacagcctatctcaaagcttgagtttgagttcgagaag
aggaaattggccaaagatgatgtccgggaattaatttaccgagagattttagagtatcat
ccccatatgctgcaagaatatttgcgcgggggagaccagatgagtttcatgtatcctagt
ggggtggatcgcttcaagcgtcaattcgctcatttggaggaaggagtttcaaagggtgaa
aaatccagtccacagcttcggcagaatgcttccttaccaagggaaagagcaattggtaac
aagcatggagatgacgagtaccacgcaaagctgaatgtaggcgagaagccatgccatgca
tcagtgacagacggcattagcaaaccgctcatgagtgctcggagcttgttgaagagtgaa
agcataagcgcttccaagtgtattggtgaaaaaccaaagcaagacagagatcaggaggat
tcccttacagagagcatggacgaaacagctgatgaggtctcagaaaaggttgctcaactg
aaaacctga

DBGET integrated database retrieval system