KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0235200-01
Entry
Os06t0235200-01   CDS       T02163                                 

Gene name
Os06g0235200
Definition
(RAP-DB) Protein of unknown function DUF231 domain containing protein.
  KO
K23877  xyloglucan O-acetyltransferase
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99986 Glycan metabolism
    Os06t0235200-01 (Os06g0235200)
SSDB
Motif
Pfam: PC-Esterase PMR5N
Other DBs
RAP-DB: Os06t0235200-01
Position
chr06:complement(join(7045245..7045542,7043884..7044992))
AA seq 468 aa
MVTTNFVQNHHLQNSQFFLLPKRQLVTYALYALIPLALLHYLLFNPVATAKKPVVVVVQA
TDDASVIASSHHEHVKVNAKQLPVPPSDQGDEGFKKNAIAGEVAAAAACDYSDGEWVPDA
RPPLYNGTSCATIKDGQNCMAHGRPDTGYLHWRWRPRRCDLPAFSPEAFLGWLRGKHLAF
VGDSLARNQAESLVCLLASRSTPELVHRDGEENRFRRWAFREHDATVSIFWSPFLVKAAE
KAERAGVRHNNVFLDAFDERWMSGLGGLDAVVLSIGHWFLIPGIYHDAGEVVGCHDCAEF
NHTETPFFAVFRQAVHRTLAEITRRHVLAAGAGTSKSKSKVVAFTTFSPAHFEGEWDKAG
ACNKTRPYKNGEKEAGYTEAEMRKTVVEEVAAADAAAAGGGGAGLRFAALDVTTLANLRP
DGHPGPYMRGDPFAGGGGGARVQNDCVHWCLPGAIDTFNEILLQTITR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtgaccaccaatttcgtgcagaaccaccaccttcagaacagccagttcttcctgctc
cccaagaggcagcttgtgacctacgccctctacgctctcatccctctcgccctcctccat
taccttctcttcaaccctgtggccactgccaagaagccggtggtggtggtggttcaggcg
acagacgatgcttcggtcatcgcctcgtctcatcacgagcatgtcaaggtgaatgccaag
cagctgcctgtgcccccttctgaccaaggagatgaagggttcaagaagaatgcgatagcc
ggagaagtggcggcggcggcggcgtgcgactactccgacggcgagtgggtgccggacgcg
cggccgcctctctacaacgggacgagctgcgccacgatcaaggatgggcagaactgcatg
gcgcacggccggccggacaccggctacctccactggcggtggcggccgcggcggtgcgac
ctcccggcgttctcgccggaggcgttcctcggctggctccgcggcaagcacctcgcgttc
gtcggcgactcgctggcgcgcaaccaggcggagtcgctggtgtgcctcctggcgtcccgc
tccacgccggagctcgtgcaccgcgacggcgaggagaacaggttccggcggtgggcgttc
cgggagcacgacgccaccgtgtccatcttctggtcgccgttcctcgtcaaggccgcggag
aaggcggagcgcgccggcgtgcggcacaacaacgtgttcctggacgcgttcgacgagcgg
tggatgtccgggctggggggcctcgacgccgtcgtgctctccatcgggcactggttcctg
atcccgggcatctaccacgacgccggcgaggtcgtcggctgccacgactgcgccgagttc
aaccacaccgagacccccttcttcgccgtgttcaggcaggcggtccaccggacgctcgcc
gagatcacccggcgccacgtcctcgccgccggcgcgggcacgagcaagagcaagagcaag
gtggtggcgttcacgacgttctcgccggcgcacttcgagggggagtgggacaaggccggc
gcgtgcaacaagacgcggccgtacaagaacggcgagaaggaggccgggtacacggaggcg
gagatgcgcaagaccgtcgtggaagaggtcgccgccgccgacgccgccgcggccggcggc
ggcggcgcgggcctgcggttcgcggcgctggacgtgacgacgctggccaacctgcggccc
gacgggcacccgggcccgtacatgcgcggcgacccgttcgccggcggcggcggcggcgcg
cgggtgcagaacgactgcgtgcactggtgcctccccggcgccatcgacacgttcaacgag
attctgctccagaccatcaccagatga

DBGET integrated database retrieval system