KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0273700-01Help
Entry
Os06t0273700-01   CDS       T02163                                 

Gene name
Os06g0273700
Definition
(RAP-DB) Protein of unknown function DUF231, plant domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif
Pfam: PC-Esterase PMR5N DUF21
Motif
Other DBs
RAP-DB: Os06t0273700-01
Position
chr06:9254049..9255368
AA seq 439 aa AA seqDB search
MKRLSIRGLLAGARRTRHAVAAKATTSVPALVALLFFFAAATFSVFSLGSFRWPGAADDG
GAAACDAALARGRGEWMRDAGAAPYYTNATCGFIQNYQNCMKHGRPSMEFLRWRWRPGDG
GEGCEPLGPFDAARFFRLVRGRSMLFVGDSLASSHVTSLVCALSQVEAPARSRDAAAGFE
HWRFPAHGFAVAYFWTPFQVRWRLTRGPPEAVGPERQGEVFAGPSDLHLDEPDERWTSAA
KSHDYVVLSASHWFARPAVYYQHGRVVGCHDCGDSNATATAIVKQPEHAQRAAFRAVLGA
LARLDGFNGTAILRTVAPTHYENGGWFDGGECTATRPASESEDGAAPEMAATEAEFYRAQ
VEEFAAAAAAAAARNGGKRARLRLMDVTRMMLLRPDGHPDRHGHGGGEHDGFEIDCLHWC
LPGAIDVWNDLLLQIIASS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctctccatccgcggcctcctcgccggggctcgccggacccgccacgccgtt
gccgccaaggccaccacgtccgtcccggctctcgtcgcgctcctcttcttcttcgccgcc
gccaccttctcggtcttctccctcggctccttccgttggcctggcgccgccgatgatggc
ggtgcggctgcctgcgacgccgcgctggcgcgggggcggggcgagtggatgcgcgacgcc
ggcgcggcgccgtactacaccaacgcgacgtgcgggttcatccagaactaccagaactgc
atgaagcacgggaggcccagcatggagttcttgcggtggcggtggcgtcccggtgacggc
ggcgaggggtgcgagccgctcgggccgttcgacgcggcgcggttcttccggctcgtgcgc
gggaggtcgatgctgttcgtcggcgactcgctggcgagcagccacgtgacgtccctcgtg
tgcgcgctgtcgcaggtggaggcgccggcgaggtcgcgcgacgcggcggcggggttcgag
cactggcgcttcccggcgcacggcttcgccgtcgcctacttctggacgccgttccaggtc
cggtggcgcctgacgcgcggcccgccggaggcggtcggtccggaacggcagggcgaggtg
ttcgccggcccgagcgacctccacctcgacgagcccgacgagcggtggacgtccgccgcc
aagagccacgactacgtcgtcctctccgcgtcgcactggttcgcgcgccccgccgtgtac
taccagcacggccgcgtcgtcggctgccacgactgcggcgacagcaacgccaccgccacg
gccattgtcaagcagccagagcacgcgcagcgggcggcgttccgcgccgtgctcggggcg
ctggcgcggctggacgggttcaacggcacggcgatcctgcgcacggtggcgccgacgcac
tacgagaacggcgggtggttcgacggcggggagtgcaccgcgacgcggccggccagcgag
agcgaggacggggcggcgccggagatggcggcgacggaggcggagttctaccgggcgcag
gtcgaggagttcgccgcggcggcggcggcggcggcggcgaggaacggcggcaagcgggcg
cggctgaggctgatggacgtgacgcggatgatgctgctccggccggacgggcacccggac
cggcacgggcatggcggcggcgagcacgacggattcgagatcgactgcctgcactggtgc
ttgcccggagcgatcgacgtgtggaacgacctgctgcttcagataatcgcatcctcatga

DBGET integrated database retrieval system