KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0354500-01Help
Entry
Os06t0354500-01   CDS       T02163                                 

Gene name
Os06g0354500
Definition
(RAP-DB) Similar to Acyl-coenzyme A oxidase 3, peroxisomal precursor (EC 1.3.3.6) (AOX 3) (Medium-chain acyl-CoA oxidase) (AtCX3).
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00071  Fatty acid degradation
dosa00592  alpha-Linolenic acid metabolism
dosa01040  Biosynthesis of unsaturated fatty acids
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01212  Fatty acid metabolism
dosa04146  Peroxisome
Module
dosa_M00087  beta-Oxidation
dosa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Os06t0354500-01 (Os06g0354500)
   00592 alpha-Linolenic acid metabolism
    Os06t0354500-01 (Os06g0354500)
   01040 Biosynthesis of unsaturated fatty acids
    Os06t0354500-01 (Os06g0354500)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Os06t0354500-01 (Os06g0354500)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     Os06t0354500-01 (Os06g0354500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
RAP-DB: Os06t0354500-01
Position
chr06:complement(join(14512391..14512884,14508877..14508994,14508677..14508784,14508416..14508588,14508243..14508342,14508057..14508131,14506401..14506531,14505946..14506081,14505374..14505493,14505141..14505287,14504950..14505054,14504776..14504877,14504398..14504646))
AA seq 685 aa AA seqDB search
MDPSYPPSATARRAAAIARHLAGLSPRDAAAVAAALEPSACLSYAPPESSEPAPAFSPLE
LRSLLDGHHLRERDWAFRAMEESPLFCQRRSGGKVFVSPDYNEGKEGQREATMRRVGYLA
RRGVFRGWLTEPGPDAELRKLALLECLGMYDHSLAIKIGVHFFLWGSAIKFLGTKRHHDK
WLSDTENYVIKGCFSMTELGHGSNVRGIETVATYDIKTREFVINTPCESAQKYWIGGAAN
HATHTIVFAQLHINGRNEGVHAFVAQIRDEHENVMPNIQIADCGHKIGLNGVDNGRIWFN
NIRVPRENLLNLVADVLPDGQYVSTIDDPDQRFAAFLSPLTLGRVNIAVNAVYISKVGVA
IAVRYALSRRAFSVTPDGPEMLLLDYPSHQRRLLPLLAKACLMSSAGNFMKRMYVKRTPE
LNKSIHIYSSALKATLTWQNMTTLQECREACGGQGLKTENRIGIFKAEFDVQSTFEGDNN
VLMQQVSKALYAEFLTAKRKNQPFKGLGLEHLNGPCPVIPDYLTSGTLRSSSFQMDLLCL
RERDLLKRFTTEVSNYLAQGENREKALMLSYQLAEDLARAFTERTILQIFLEDEKNIPTG
SLKDILGLLRSLYVMVCIDESASFLRYGCLSRENVAAARKEVMTLCSELRPHALAIVSSF
GIPDAFLSPLAFDWIEANARSSGNE
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggatccatcgtaccctccctccgccaccgcccgccgcgccgccgccatcgcccgccac
ctcgccggcctctcccctcgcgacgccgccgccgttgctgcagcgctggagccctccgcg
tgcctgagctacgcgcccccggagtcgtcggagcccgcccctgcgttctcgccgctggag
ctccgctcgctcctcgacgggcaccacctccgggagcgcgactgggcgttccgcgcgatg
gaggagagcccgctcttctgccagcgccgcagcggcggaaaggtgttcgtgtctccggac
tacaacgagggcaaggaggggcagcgggaggccacgatgcggcgggtcggctacctggcg
cggcggggcgtgttccggggctggctcacggagccggggcccgacgccgagctccgcaag
ctcgcgctgctcgagtgcctcggcatgtatgaccactccctcgccatcaagatcggcgtc
cacttcttcctctggggcagcgcaatcaagtttcttggaacaaagcgccaccatgacaaa
tggttgtcggacacagaaaattatgttatcaagggttgtttttccatgacagaactgggt
catgggagcaatgtccgaggaattgagacagtggctacttatgatattaaaacaagagag
tttgtgataaatactccttgtgaatcagcccagaagtactggattggtggagctgctaat
catgctacacatactatagtctttgcgcagctccatataaatgggagaaatgaaggagtc
catgcttttgtagctcagattagggatgaacatgaaaatgttatgcctaatatccagata
gctgactgtggccataaaattggattaaatggtgttgataatggacgaatttggtttaac
aatatacgtgttcctcgagagaatttgctgaatcttgttgctgatgttttgccggatggg
caatatgttagcacgatagatgaccctgatcagaggtttgcagcatttttatctccactt
acacttggtcgagttaatattgcagttaatgcggtttatatttcaaaggttggcgttgca
attgctgtgagatatgctttgtcaaggagagccttttcagttacaccggatggtcctgaa
atgctgttacttgattatcccagtcaccagcgacgccttctaccactgctagcaaaagca
tgtctgatgagcagtgctggtaattttatgaaaaggatgtatgtgaagaggactcctgaa
cttaacaaatctatacacatttactctagtgctcttaaagctacacttacctggcagaat
atgaccacacttcaggagtgccgtgaagcttgtggtggccaaggtttgaagacagagaat
cgcataggaattttcaaagctgaatttgatgtccagtctacatttgagggcgacaataat
gttctaatgcagcaggtaagcaaagccctttatgctgaatttttgacagcaaaaaggaag
aatcaaccattcaagggattgggcttggaacacttgaatggtccttgccctgttattcct
gattatctgacaagtggcacactaagaagctccagtttccagatggacttgctctgcttg
agggagcgagatttactgaaacgattcaccacggaggtttctaactatctggcacaagga
gaaaacagagagaaggctttgatgctgagctaccaactcgctgaagacttagctagagca
tttactgagcgcacaattttgcaaatatttttggaggatgagaagaatattcctactggt
tctttaaaggatatattgggcttactaaggtctttatatgttatggtttgcatagacgaa
tctgcatcctttttgagatatggttgcctatcgcgagagaatgtagccgctgctaggaaa
gaagtgatgacactgtgcagtgaactcaggccccacgcacttgctattgtcagttccttc
ggaatcccagatgccttccttagcccactcgcttttgactggattgaggcaaatgcacgg
tcttctgggaatgaatga

DBGET integrated database retrieval system