KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0487900-01
Entry
Os06t0487900-01   CDS       T02163                                 

Gene name
Os06g0487900
Definition
(RAP-DB) Peptidase C48, SUMO/Sentrin/Ubl1 family protein.
  KO
K16287  ubiquitin-like-specific protease 1C/D [EC:3.4.22.68]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dosa04121]
    Os06t0487900-01 (Os06g0487900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     Os06t0487900-01 (Os06g0487900)
Ubiquitin system [BR:dosa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   Os06t0487900-01 (Os06g0487900)
SSDB
Motif
Pfam: Peptidase_C48
Other DBs
RAP-DB: Os06t0487900-01
Position
chr06:complement(join(16745344..16745550,16744778..16744829,16743866..16743924,16743559..16743797,16742726..16742774,16740421..16740494,16739496..16739525,16739314..16739409,16738061..16738160,16736965..16737059,16736650..16736772,16736212..16736326,16733814..16733924,16733475..16733693))
AA seq 522 aa
MAGGEDGADGVGDDTELRRFSDVELLEKSRRIQGELSGGIERRLKDRGAKFRRLLDAIVR
EIDRRKAATDDDRCARVVQSGCAESSVKQQAVTISDFRSSFGIDEEAGVDVSHLETSACI
GDPKTSTDNEGILCEEEDSCKCKPSTSQKASYVDRSTYMENIDAADDGKDNGYSRICKDA
HTSRKRNGEFSPTFSMRLRSRKVVEEVVLLDGDTCISDSAEKTSSACDAMKIHYPSWDTP
NSIELSYSDMKCLEPESLLSSPILNFYIMYLMGQMPSTSRLGGKYHIFNTYFFSKLEALT
SKVDNDAYFLNLRRWWKGVDIFKKAYIIIPVHADAHWSLVIICMPAKEDQSGPTIFHLDS
LKFHSSRFIFSTVERFLKEEWNYLNKTGSLEDCHLHESVWKNLPRKIKKKAVTVPQQDNE
YDCGVFVLYYMRRFIEEAPERLNNKDSSNMFGEGWFQREEASALRKEMQALLLRLFEEAK
DNNHMRDPTTPVSATAEHPVEVLSTEPAVPDHPRNAVGVATS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggccggcggcgaggacggggccgacggcgtcggagatgacaccgagcttcgcaggttc
tcagacgtggagctgctggagaagtcgcggcgcattcagggggagctcagtgggggtatc
gagcgaaggctcaaggaccgcggggccaagtttcgccgcttgctagacgccatcgtccgc
gagattgatcgccgtaaggcagcaacggatgatgacagatgcgcaagggtagttcaatcg
ggatgtgcagaatcatcagttaaacaacaagcagtaaccatatcagattttcggtcctcc
tttgggatagatgaagaggcaggcgttgatgtatctcatttggaaacaagtgcatgcatt
ggcgacccaaaaacttcaacagataatgaggggatcttgtgtgaagaggaagattcctgt
aagtgtaaaccctctacgtctcaaaaggcatcatatgttgataggtcaacttatatggaa
aatatagatgctgctgatgatggcaaggataatggctacagtaggatatgcaaagatgcc
cacacttctaggaaaaggaatggagaattttcacctaccttttcaatgcgattgcgatca
agaaaggtggttgaagaggtggttctactcgatggagatacttgcatttcagactctgca
gaaaaaacatcctctgcatgtgatgcaatgaagatacactatccttcatgggacacccct
aattctattgagctttcttattctgacatgaagtgtcttgagcctgaatcattgttgtcc
tcacctatactgaacttctacattatgtacctaatgggacaaatgccatcgacaagtagg
cttggaggcaagtatcatattttcaatacatacttcttcagcaaacttgaagccttgaca
tcaaaggtggacaatgatgcttatttcttgaatctgagaagatggtggaaaggtgtagat
atatttaaaaaggcatacataataattcctgtgcatgcagacgcacactggagcttggtc
attatatgtatgcctgcaaaggaagaccaatcagggcccaccatatttcatttggattca
ctgaagtttcatagcagcagatttattttcagcaccgttgagagattccttaaagaagaa
tggaactacctgaataaaactggttctttagaagattgtcatctacatgaatcagtgtgg
aagaaccttcctcggaaaattaagaagaaagcagttacagttccacagcaggacaatgaa
tacgattgtggtgtctttgttctgtactatatgcgacgctttatcgaggaagcacctgaa
aggcttaacaacaaggactcatctaatatgtttggcgaagggtggttccaacgtgaagag
gcttctgcactgcgaaaggaaatgcaagctctgcttcttcggttgtttgaggaagctaaa
gacaacaaccacatgagagatccaacaacaccagtgtcagcaacagcggagcaccctgtt
gaagtcttgtcaaccgagccagcagtaccagaccaccctcggaatgcggttggcgtcgcc
acctcatag

DBGET integrated database retrieval system