KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0527100-01
Entry
Os06t0527100-01   CDS       T02163                                 

Symbol
Os06g0527100
Name
(RAP-DB) Similar to Cyclic nucleotide-gated channel A (Fragment).
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    Os06t0527100-01 (Os06g0527100)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dosa04040]
    Os06t0527100-01 (Os06g0527100)
Ion channels [BR:dosa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   Os06t0527100-01 (Os06g0527100)
SSDB
Motif
Pfam: Ion_trans cNMP_binding Cation_ATPase_C
Other DBs
RAP-DB: Os06t0527100-01
Position
chr06:join(19546122..19546153,19547038..19547554,19547991..19548203,19549491..19549765,19549861..19549972,19550547..19550783,19551947..19552645)
AA seq 694 aa
MMMGREDKYVRFEDWRSEQSVMSPRRHNALSSLKERTAGVFAFLGNLVHSETLKRLVLHE
RKLTTRTLHPQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINDNNTCWYLDKKLEITAS
VLRFFTDIFYILHIIFQFRTGYIASSLTTFGRGVLVEDRYAIAKRYLSTYFLIDVFAVLP
LPQVVILVVLPNLGGSEVTKAKNILMFIVICQYVPRLIRIRPLYLQITRSAGVITETPWA
GAVLNLLIYLLASHVLGALWYLLSIERKDACWRDMCSNNSTVCNQAYLYCGDKENSILRT
ACLPIDSNDIDPNFGIYVPALNNVSQSTNFLAKLFYCVWWGLQNLSSLGQNLKTSTYAWE
NLFAVFVSISGLVLFALLIGNVQTYLQSAHLREEEMRVKSRDTDQWMSYRLLPENLKERI
RRHEKYRWHQTSGVDEELLLMNLPKDLRRAIKRHLCLSLLMRVPMFENMDDQLLNALCDR
LKPVLYTEGSCIIREEDPVNEMLFIMRGNLMSMTTNGGRTGFFNSDVLKGGDFCGEELLT
WALDPTSVSSLPSSTRTVKTMSEVEAFALRAEDLKFVATQFRRLHSKQLQHTFKFYSQHW
RTWAACFIQAAWHRYCRKKIEDSLREKEKRLQFAIVNDGATTLSFRAAIYASRFAGNMMR
ILRRNATRKARLKESVPARLLQKPAEPNFAAEEQ
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgatgatgggaagagaggacaaatatgtgagatttgaggactggagatctgagcagtca
gttatgtcaccacggaggcataatgctttaagttcacttaaagaaagaactgctggagtt
tttgcattcctaggaaaccttgtgcattctgaaaccttaaagagattggtgctgcatgaa
aggaagttgacaactagaactcttcatcctcagggaccatttctgcaaagctggaacaag
atatttgttttgtcatgtatctttgcagtttctgtggacccattgttcttctatattccg
gttatcaatgacaacaacacatgctggtatttggataaaaagttggaaatcacagcaagt
gtcctgcgctttttcacagatatcttctatatactccatatcatatttcagttcaggaca
ggttatattgcgtcttctcttacaacttttggtcggggtgtcttggttgaggatagatat
gcaatagcaaagcgatacttgtcaacatattttctgatcgatgtctttgctgttctaccc
ctccctcaggtggttattttggttgtgctacctaatcttggaggctcagaggttacaaaa
gccaaaaatatcttgatgtttatagttatatgccaatatgtgcctcggctgatccgaata
aggccactgtatctccaaatcacaaggtctgctggggtaattacagagacaccatgggct
ggtgctgttttgaaccttttaatttacttgctcgccagtcatgtccttggagcactctgg
tacttgctttccattgaacgcaaagatgcctgctggagagacatgtgtagtaataatagt
acagtctgtaatcaggcatatttgtactgtggggataaggaaaactcgatcttacggact
gcttgccttccaatcgactcaaacgatatagatccgaactttggaatttatgtgccagct
ctaaataatgtctcgcaatcaactaattttttggcaaaactattctattgtgtttggtgg
ggtctgcaaaatcttagctctctgggccaaaaccttaagacaagcacttatgcatgggag
aatctgtttgcagtttttgtctcaatatcaggcttggttctgtttgcactgctaattggt
aatgtgcagacctatttgcagtcagcccatctgagagaagaagaaatgagagtgaaaagc
cgtgatacagatcaatggatgtcatatcgactgcttcctgagaatctcaaggaacgaata
cgtcgtcatgaaaaatatagatggcaccagacgagcggggttgatgaagaactcttgctt
atgaacctccccaaggatcttaggagggctataaaacggcatctttgcttatcacttctt
atgagggttccaatgtttgaaaacatggatgatcaactcttgaatgccttgtgcgaccgc
ctaaagcctgttctttatacagaaggtagctgcataattcgtgaagaggatccagtaaat
gaaatgctgttcatcatgagaggtaatctcatgagtatgacaacgaatggtggaagaact
ggcttcttcaactctgatgttttgaaaggtggagatttctgtggcgaagagctcctgacc
tgggctcttgaccccacgtcagtttccagcctccctagctcaaccaggacagtgaagacg
atgtccgaagtcgaagcttttgccctgagggctgaagacttgaagtttgtggccacccag
ttccgacggctacacagcaaacagctccagcacacgtttaagttctactcgcagcattgg
agaacctgggcagcctgtttcatacaagcagcctggcataggtactgcagaaagaagatc
gaagactctctacgcgagaaggagaagaggttgcagttcgcaatcgttaatgacggtgct
acaactctcagcttcagggcagcgatatatgcttcgcgtttcgctggcaacatgatgcgg
atcttgaggagaaatgccacccgcaaggctcggttgaaggaaagtgtgcctgcaaggttg
ttacaaaaaccagcagaacccaactttgctgcagaagagcagtag

DBGET integrated database retrieval system