KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0649500-01
Entry
Os06t0649500-01   CDS       T02163                                 

Gene name
Os06g0649500
Definition
(RAP-DB) WD40 repeat-like domain containing protein.
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    Os06t0649500-01 (Os06g0649500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dosa03021]
    Os06t0649500-01 (Os06g0649500)
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os06t0649500-01 (Os06g0649500)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     Os06t0649500-01 (Os06g0649500)
   Coactivators
    SAGA/TFTC/STAGA complex
     Os06t0649500-01 (Os06g0649500)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     Os06t0649500-01 (Os06g0649500)
    STAGA complex
     Os06t0649500-01 (Os06g0649500)
    TFTC complex
     Os06t0649500-01 (Os06g0649500)
    SAGA complex
     Os06t0649500-01 (Os06g0649500)
    SLIK complex
     Os06t0649500-01 (Os06g0649500)
SSDB
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Nup160 WD40_like Cytochrom_D1 PALB2_WD40
Other DBs
RAP-DB: Os06t0649500-01
Position
chr06:join(26529398..26529531,26530392..26530473,26531001..26531079,26531179..26531276,26531404..26531460,26532044..26532131,26532241..26532350,26532533..26532634,26532889..26533040,26533841..26533951,26534027..26534094,26534185..26534226,26534640..26534804,26534906..26534982,26536302..26536418,26536557..26536822,26537342..26537437,26537521..26537587,26537680..26537733)
AA seq 654 aa
MEDEEMEKKVQQYLQRKGFRLTELALQEERNRISTSSVSDVALARSENDPARYYDGYSKL
RTWAYSSLDQYKHELLRVLYPVFIHSFMDLVAEGHTQEARSFFHTFHEDHELMHSRDLQK
LEGILSPSHLEEMELARSLRKNQFRIKLCEYSYELLLQYLQKTQALVVLGIINERTTFDV
SPGQPSLISDDTDVVALVGTKKDLAKQINLKEVHWGLLEDSVEERMEKTLLESDKTEAES
KDADAEDNNKRKSSEGGKQGGSVKKVKKDKIAGATGKTNKSETSIVSVAPRVKPELTLPV
IPVEVEQSILEDLRNRAQLNSLALPSVSFYTFLNTHNGLNCSSISHDGSLVVGGFSDSSV
KVWDMSKIGQPPKTSSPQGENGLSQGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDF
LLSSSSDSTIRLWSTKLNANLVCYKGHNYPVWDVQFSPVGHYFASASHDRTARIWSMDKI
QPLRIMAGHLSDVDCVQWHVNCNYIATGSSDKTVRLWDVQTGECIRMFIGHRSMVLSLAM
SPDGRYMASGDEDGTIMMWDLSSGRCVSPLGGHSSCVWSLAYSCEGALLASGSADCTVKL
WDVASSTKVLKTDDTSTNRLRMLKTLRTKSTPVYTLRFSRRNLLFAAGALSLGS
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggaggacgaggagatggagaagaaggtgcagcagtacctgcagcggaaggggttccgc
ctcaccgagctcgcgttgcaggaggagcgcaaccgcatctccacctcctccgtctccgac
gtcgcgctcgccaggtcggaaaatgatccggcaagatactatgatggttatagtaaacta
agaacatgggcatacagttctctcgatcagtacaagcatgaattactccgtgtcctttac
ccagtgtttatccattccttcatggatctagtggcagagggacatacacaggaagctcgg
tcctttttccacacgttccatgaagaccatgaactgatgcattctagggatctccagaaa
ctggaaggcattctttctccttcacatttggaggaaatggaactggccagatctttaagg
aaaaatcaattcagaattaagttatgtgagtattcatatgagttactcctccagtatctc
cagaaaacacaagctcttgtggttcttggaataataaatgaacgcacaacttttgacgta
tcccctggtcagccatctttaatctctgatgacacggatgttgttgctctagttggaaca
aagaaggatttggcaaaacaaataaatctgaaggaggtgcattgggggttgcttgaagat
tcagttgaagagcgcatggagaaaacacttttagaatcagataaaactgaagcagaaagc
aaggatgcagatgccgaagataacaataagagaaaatcttcggaaggtggaaagcaggga
ggttctgttaaaaaggtcaaaaaagataagattgcaggagccacagggaaaaccaataaa
tctgaaacaagcatagtttcggtggcacctcgtgtgaaaccagagcttacacttccagtg
attcctgttgaagtcgagcagtcaattcttgaggatttgcgaaaccgtgcacagttgaat
agcctggcattgccatctgttagcttctacacattccttaatactcataatgggctaaat
tgctcatcaatttcacatgacggctctttggttgtgggtggattctctgactcatcagtg
aaggtttgggatatgtcaaagattggccaaccgccgaaaacatctagtccacaaggagag
aatggactttcccagggtgagcgcacatcagcatcagattatggaaaaagaccttataca
ttattccaaggtcattctggaccagtttattccgctgcatttagcccattcggagatttt
ctcttgtcatcatcctcagactcaacaattcgactatggagtaccaagttgaatgctaat
cttgtttgctacaaaggacacaactaccctgtttgggatgtacaatttagcccagttggt
cattattttgctagcgcttctcatgacaggactgctagaatttggtcaatggataaaatc
cagcctttgcggataatggctggacatctctctgatgttgattgtgtgcagtggcatgtt
aactgtaactacattgccaccggctctagtgacaaaactgtaagattatgggatgttcaa
actggtgaatgtatacggatgttcattggccataggagtatggttttatcattggctatg
tctcctgatgggcgatacatggcctccggagatgaagatggaaccatcatgatgtgggat
ctctcttctggtcggtgcgtttcaccacttgggggacacagctcttgtgtgtggtcactt
gcttacagttgtgaaggggcattgcttgcatctggatcagccgactgcactgtgaaactc
tgggatgttgcctccagcacgaaggtccttaagacagatgatacctcaactaaccggctg
aggatgctcaaaactctccgtacaaaatcaactcctgtttatactctgcggttttctcgg
cgaaatcttttatttgcggctggtgctctctcacttggctcctaa

DBGET integrated database retrieval system