KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0667100-01
Entry
Os06t0667100-01   CDS       T02163                                 

Gene name
Os06g0667100
Definition
(RAP-DB) Similar to Nuclear Y/CCAAT-box binding factor C subunit NF-YC.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os06t0667100-01 (Os06g0667100)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os06t0667100-01 (Os06g0667100)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone
Other DBs
RAP-DB: Os06t0667100-01
Position
chr06:27631902..27632654
AA seq 250 aa
MEPSSQPQPAIGVVAGGSQVYPAYRPAATVPTAPAVIPAGSQPAPSFPANPDQLSAQHQL
VYQQAQQFHQQLQQQQQRQLQQFWAERLVDIEQTTDFKNHSLPLARIKKIMKADEDVRMI
SAEAPVIFAKACEIFILELTLRSWMHTEENKRRTLQKNDIAAAITRTDMYDFLVDIVPRD
DLKEEGVGLPRAGLPPLGVPADSYPYGYYVPQQQVPGAGIAYGGQQGHPGYLWQDPQEQQ
EEPPAEQQSD
NT seq 753 nt   +upstreamnt  +downstreamnt
atggagccatcatcacaacctcagccggcaattggtgttgttgctggtggatcacaagtg
taccctgcataccggcctgcagcaacagtgcctacagctcctgctgtcattcctgccggt
tcacagccagcaccgtcgttccctgccaaccctgatcaactgagtgctcagcaccagctc
gtctatcagcaagcccagcaatttcaccagcagcttcagcagcagcaacagcgtcaactc
cagcagttttgggctgaacgtctggtcgatattgaacaaactactgacttcaagaaccac
agcttgccacttgctaggataaagaagatcatgaaggcagatgaggacgttcgcatgatc
tccgcagaggctcctgtgatctttgcgaaagcatgtgagatattcatactggagctgacc
ctgagatcatggatgcacacggaggagaacaagcgccgtaccttgcagaagaatgacata
gcagctgccatcaccaggacggatatgtacgatttcttggtagatatagttcccagggat
gacttgaaggaggagggagttgggctccctagggctggattgccgcccttgggtgtccct
gctgactcatatccgtatggctactatgtgccacagcagcaggtcccaggtgcaggaata
gcgtatggtggtcagcaaggtcatccggggtatctgtggcaggatcctcaggaacagcag
gaagagcctcctgcagagcagcaaagtgattaa

DBGET integrated database retrieval system