KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0724500-01
Entry
Os06t0724500-01   CDS       T02163                                 

Gene name
Os06g0724500
Definition
(RAP-DB) WD40 repeat-like domain containing protein.
  KO
K11804  DDB1- and CUL4-associated factor 8
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dosa04121]
    Os06t0724500-01 (Os06g0724500)
Ubiquitin system [BR:dosa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     Os06t0724500-01 (Os06g0724500)
SSDB
Motif
Pfam: WD40
Other DBs
RAP-DB: Os06t0724500-01
Position
chr06:complement(join(30779443..30779538,30778854..30779105,30778601..30778744,30777797..30778516,30777141..30777371))
AA seq 480 aa
MPREGTRMAGLWEREVGCLPPKLFANSVMASQDFVRSLGVQKRLRKHRGCVNTISFNEDG
SLLLSGSDDRAAVLWNWQEGTPTFAFHTGHSDNVFHALFMPFSGDRSIITCAADGQVRHS
QIQEGGRVITNELVDTEVAVHKLAIEPGNPHTFFSCGDNGSVFLFDLREKYVAELFKCAE
VDHFGGDTIELYAIAIDPRKPSCFAVAGSDEYVRIYDSRKIDVNGNSSFGRPIEYFCPPH
MMGENKDGISGLAFSQTSELLASYSYDNIYLFSREHGLHFNNIEVGKRLLMDEIEGDCHI
NTAPLPFCRDKLPAPQIFKGHRNKHTMKGVNFLGPNCDYVTTGSDCGRVFIWRKKDGELM
RVMKGDKQIVNCVEQHPYGIVIANCGIDKDIKIWAPGGSENPDEVETDSCCSDISESYDS
VYFDDYIFSSDFDSSEEDDEDDDDDDDDDDDDEEDGLSVSINEDMSYEEKDAASDHDSDV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgccgcgggaggggacgcggatggcggggctgtgggagcgcgaggtcggctgcctcccg
cccaagctcttcgccaactccgtcatggcctcccaggactttgtgcggtctctcggtgtc
cagaagaggctgcggaagcacaggggctgtgtgaataccatcagctttaacgaggatggg
agcttgctcctgtccggttcggacgatcgggccgctgtactgtggaattggcaagagggg
acgcctaccttcgcgttccacactggccacagcgacaatgtgttccatgctctgttcatg
cccttctcaggtgaccggagcatcatcacatgcgctgctgatggacaggtgaggcattcg
caaatacaagaaggtggtcgtgtaattacaaatgagctagttgatacagaggtagcagtg
cacaaactagctattgagcctggaaatcctcacacattctttagctgcggagataatggc
tccgtttttctttttgacctaagggagaaatatgttgctgaactctttaaatgcgcagaa
gttgatcattttggtggtgataccattgaactctatgctattgccatagacccgagaaag
cctagttgttttgcagttgctggatctgatgagtatgtgagaatatatgatagccgcaag
attgatgtgaatgggaattctagttttggtcggccaattgaatacttttgccctccacat
atgatgggcgaaaacaaagatggaatatctggtttggcattctcgcagaccagcgaacta
ttggcatcctatagttatgataacatctaccttttctcgagagaacatggcttacacttc
aacaatattgaggtaggaaaacgactcctgatggatgagattgaaggagactgccatata
aatacagctccattacccttttgtagagataagttgcctgcacctcaaatattcaaggga
catcgtaacaagcacaccatgaagggtgttaatttccttgggcccaactgtgactatgtt
accactggatcagactgtggccgtgtatttatttggaggaagaaggatggggagcttatg
cgggttatgaaaggggataaacagattgtgaactgtgttgagcagcacccttatgggatt
gttattgcaaactgtggcattgataaagatatcaagatttgggctcctggtggaagtgag
aaccctgacgaggttgagacagattcttgttgctctgatatcagtgagtcctatgactcg
gtttactttgatgattacatattttcctcggattttgattcatctgaagaggacgacgaa
gacgacgacgacgatgatgatgatgatgacgatgacgaagaagatggccttagtgttagt
atcaacgaagacatgagctatgaagagaaagatgcagccagcgaccatgacagcgatgtt
taa

DBGET integrated database retrieval system