KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0729000-01
Entry
Os06t0729000-01   CDS       T02163                                 

Gene name
Os06g0729000
Definition
(RAP-DB) Phytoene synthase 1 (EC 2.5.1.32).
  KO
K02291  15-cis-phytoene synthase [EC:2.5.1.32]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00906  Carotenoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00097  beta-Carotene biosynthesis, GGAP => beta-carotene
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Os06t0729000-01 (Os06g0729000)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dosa01006]
    Os06t0729000-01 (Os06g0729000)
Enzymes [BR:dosa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.32  15-cis-phytoene synthase
     Os06t0729000-01 (Os06g0729000)
Prenyltransferases [BR:dosa01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   Os06t0729000-01 (Os06g0729000)
SSDB
Motif
Pfam: SQS_PSY
Other DBs
RAP-DB: Os06t0729000-01
Position
chr06:complement(join(31054921..31055356,31054761..31054811,31053760..31053932,31052927..31053162,31052630..31052822,31052343..31052516))
AA seq 420 aa
MAAITLLRSASLPGLSDALARDAAAVQHVCSSYLPNNKEKKRRWILCSLKYACLGVDPAP
GEIARTSPVYSSLTVTPAGEAVISSEQKVYDVVLKQAALLKRHLRPQPHTIPIVPKDLDL
PRNGLKQAYHRCGEICEEYAKTFYLGTMLMTEDRRRAIWAIYVWCRRTDELVDGPNASHI
TPSALDRWEKRLDDLFTGRPYDMLDAALSDTISKFPIDIQPFRDMIEGMRSDLRKTRYKN
FDELYMYCYYVAGTVGLMSVPVMGIAPESKATTESVYSAALALGIANQLTNILRDVGEDA
RRGRIYLPQDELAEAGLSDEDIFNGVVTNKWRSFMKRQIKRARMFFEEAERGVTELSQAS
RWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLALPVAYGRSLLMPYSLRNSQK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcggccatcacgctcctacgttcagcgtctcttccgggcctctccgacgccctcgcc
cgggacgctgctgccgtccaacatgtctgctcctcctacctgcccaacaacaaggagaag
aagaggaggtggatcctctgctcgctcaagtacgcctgccttggcgtcgaccctgccccg
ggcgagattgcccggacctcgccggtgtactccagcctcaccgtcacccctgctggagag
gccgtcatctcctcggagcagaaggtgtacgacgtcgtcctcaagcaggcagcattgctc
aaacgccacctgcgcccacaaccacacaccattcccatcgttcccaaggacctggacctg
ccaagaaacggcctcaagcaggcctatcatcgctgcggagagatctgcgaggagtatgcc
aagaccttttaccttggaactatgctcatgacggaggaccgacggcgcgccatatgggcc
atctatgtgtggtgtaggaggacagatgagcttgtagatggaccaaatgcctcgcacatc
acaccgtcagccctggaccggtgggagaagaggcttgatgatctcttcaccggacgcccc
tacgacatgcttgatgctgcactttctgataccatctccaagtttcctatagatattcag
cctttcagggacatgatagaagggatgcggtcagacctcagaaagactagatacaagaac
ttcgacgagctctacatgtactgctactatgttgctggaactgtggggctaatgagtgtt
cctgtgatgggtattgcacccgagtcgaaggcaacaactgaaagtgtgtacagtgctgct
ttggctctcggcattgcaaaccagctcacaaatatactccgtgacgttggagaggacgcg
agaagagggaggatatatttaccacaagatgaacttgcagaggcagggctctctgatgag
gacatcttcaatggcgttgtgactaacaaatggagaagcttcatgaagagacagatcaag
agagctaggatgttttttgaggaggcagagagaggggtgaccgagctcagccaggcaagc
cggtggccggtctgggcgtctctgttgttataccggcaaatccttgacgagatagaagca
aacgattacaacaacttcacaaagagggcgtacgttgggaaggcgaagaaattgctagcg
cttccagttgcatatggtagatcattgctgatgccctactcactgagaaatagccagaag
tag

DBGET integrated database retrieval system