KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0124500-01Help
Entry
Os07t0124500-01   CDS       T02163                                 

Gene name
Os07g0124500
Definition
(RAP-DB) Similar to Eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) (eIF3c).
  KO
K03252  translation initiation factor 3 subunit C
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Os07t0124500-01 (Os07g0124500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dosa03012]
    Os07t0124500-01 (Os07g0124500)
Translation factors [BR:dosa03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    Os07t0124500-01 (Os07g0124500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
RAP-DB: Os07t0124500-01
Position
chr07:join(1275177..1275200,1275335..1277161,1277519..1278478)
AA seq 936 aa AA seqDB search
MASRFWGQGDSDSEEEEQEIESEAGSESEDEGGDAGGRSNQNRYLRTTNASDSDESDSGQ
RVVRSLKDKRNEELKITVDQMRNAMKINDWVNLQESFEKLNKQLEKVVRVNESTTVPNMY
VKALVLLEDFLAEALANKEAKKKMSSSNAKALNAMKQKLKKNNKQYENLIQECREHPERF
EDDDVEDKDDDDETDDDASDADIEDPEKMVMSESEEEGDDDEEGDQDGGAWEKKISKKDK
LMDKQFLKDPSEITWDIVDKKLKEIVASRGKKGTGRIERVEQLTFLTRVAKTPAQKLEIL
FHVISAQFDVNPSLLGHMPVNMWKKCVNNMLLVLDILQQYPNIVVDTSVEPDEKETQKGA
DYDGQIHVTGDLVAFLERLDSEFFKSLQCTDPYTKDYVQRLRDEPLFLVVAQNVQDYLER
VGNFKAEAKVALRRVELVYYKPQEVYDAMRKLAEQDEDSREDDDADADEERQVVDDNRGP
PPFVVIPEVVPRKPTFPESGRALMDALMSVIYKYGDERTKARAMLCDIYHHAISDKFSVA
RDLLLMSHLQDGVQLMDISSQILFNRVMAQLGLCAFRAGLIIEAHGCLSELYSTGRVKEL
LAQGVQQSRYHEKTPEQERLERRRQMPYHMHINLELLEATHLICAMLIEVPNMAASTYDR
RKSMNRTFRRLLEISERQTFVGPPENVRDHVMAATRALRKGDYQKAFDVINSLEIWKLLR
NKEHVLEMLKLKIKEEALRTYLLSYSSCYESLSLDQLTTMFDLSEQQAHSIVSKMMMHEE
LHASWDQPTKCIIFHNVDQTRLQGLLFQMSDKLSVLVESNERAYEAKTGGTLEGAPPRRR
GGDGQDSSNLGKWQENFVSSQGRQGGGRSGYSGRVGGPGRGGGGYQRDRGSQGSRGGYGG
GSRFQDGGRSRNQSGSMARGGDGGARMVSLNRSGRG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccgtttttggggacagggagacagcgactccgaggaggaggagcaggagatt
gagtcagaagcaggaagtgaaagcgaagatgaaggtggtgatgccggggggcgttcaaac
cagaaccgctatttgaggaccaccaacgcaagcgacagtgacgagtctgattctggtcag
cgtgtggtccgctccttgaaggataagcgcaatgaggagttgaaaattacggttgatcag
atgcgcaatgcaatgaagatcaatgactgggtgaatttacaagagagtttcgagaagctc
aacaagcagcttgagaaggtggttcgtgtcaatgaatccaccacagttccaaatatgtac
gtcaaggctcttgtattactggaggacttccttgctgaggccctagcaaacaaagaggcc
aagaagaagatgagcagcagcaatgcaaaggcactcaatgcaatgaaacagaaactaaag
aagaacaacaagcagtatgagaacctgatccaagagtgcagagagcatccagagcgcttt
gaagatgacgatgtggaagacaaggatgacgatgatgagacagatgatgatgctagtgat
gcagacattgaggatcctgaaaagatggttatgtctgaatcagaggaggaaggagatgat
gatgaggagggtgaccaggatggtggagcctgggaaaagaagataagcaagaaagataag
cttatggacaagcagtttttgaaagatcccagtgagattacttgggatattgttgataaa
aagctcaaggagattgtggcgtcaaggggtaaaaaaggcacagggaggattgagcgtgtt
gagcagctaacctttttgacccgtgtggcgaaaacacctgctcagaagcttgaaattctc
tttcatgtgatttctgcccaatttgatgtcaaccctagcttacttggtcacatgccagtc
aacatgtggaagaagtgtgttaataacatgcttcttgtgcttgatatactgcaacagtat
cccaatattgtagtagacacctccgtggagcctgatgagaaggaaactcagaagggtgct
gactatgatggacaaatccatgtgacgggtgacctggttgcattcctggagagattggat
tctgagtttttcaaaagtttgcagtgcactgatccatacacgaaagattatgttcagagg
ctcagggatgaacctttgtttttggttgttgcacagaatgtccaagattacctggaacgt
gtcggtaactttaaggctgaagctaaggttgcactgcgtcgtgttgaattggtctactac
aaacctcaggaggtatatgatgcaatgagaaagcttgcagagcaggatgaagatagtagg
gaggatgatgatgcagacgctgacgaggagcgtcaagtagttgatgacaataggggccct
ccaccatttgttgtgatccctgaggtcgtgcctaggaagcctactttcccagagagtggc
agagctttgatggatgcgctgatgtctgtgatttacaaatatggtgatgaaaggaccaaa
gcccgggcaatgctgtgtgacatttatcaccatgctatctctgataaattttctgtggca
cgtgacttgcttttaatgagccatttacaagacggggttcaactcatggacatatcatca
cagattctgttcaacagagtcatggcccagttggggctgtgtgcttttagggctggtttg
ataattgaagctcatggttgcttgtctgagttatattcaactgggagagtgaaggagttg
cttgcacaaggtgtgcaacaaagtcgataccatgaaaaaactcctgaacaggaaaggctt
gagaggagaaggcaaatgccttaccatatgcatataaaccttgaacttttggaagccact
cacttgatttgtgccatgctgattgaggtccccaatatggctgccagtacttatgacagg
aggaagtctatgaacagaacattccgtaggcttcttgagatcagtgagaggcagactttt
gtcgggccaccagaaaatgtgagggaccatgtaatggctgcaacaagagccctccgcaag
ggtgactaccagaaggctttcgatgtcattaattcgctggagatctggaagcttttgagg
aacaaggagcatgttcttgagatgctgaaacttaagatcaaagaagaagctcttagaacc
tatctcttgtcatactcttcttgctacgagtccctgagccttgaccagctcactacaatg
tttgaccttagtgagcaacaagctcatagcattgttagcaagatgatgatgcatgaagag
cttcatgccagctgggatcaaccaaccaagtgcattattttccacaatgttgatcaaact
aggcttcagggactactcttccagatgtctgataagctctctgtccttgtggagagcaat
gagagggcatatgaggccaaaactggtggtacccttgagggagcaccacccaggcgtagg
ggtggtgatggtcaggactcatccaacttgggcaagtggcaggagaacttcgtatcatca
caagggcggcaaggcggcgggaggtctggatactcaggcagagttggaggccctggaaga
ggtggtggtggctaccagagggacaggggtagtcagggttcccgtggaggctatggtggt
ggttcgcgcttccaagatgggggaaggtctcgcaaccagtctggttctatggcaagagga
ggtgatggtggtgcacgcatggtgagcctgaacaggtctggtagaggttag

DBGET integrated database retrieval system