KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0141400-01
Entry
Os07t0141400-01   CDS       T02163                                 

Gene name
Os07g0141400
Definition
(RAP-DB) Similar to 23 kDa polypeptide of photosystem II.
  KO
K02717  photosystem II oxygen-evolving enhancer protein 2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Os07t0141400-01 (Os07g0141400)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:dosa00194]
    Os07t0141400-01 (Os07g0141400)
Photosynthesis proteins [BR:dosa00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    Os07t0141400-01 (Os07g0141400)
SSDB
Motif
Pfam: PsbP PsbQ
Other DBs
RAP-DB: Os07t0141400-01
Position
chr07:complement(join(2137777..2138229,2137626..2137676,2137119..2137379))
AA seq 254 aa
MASTSCFLHQSTARVAARVASPSPATRTHLLVCRAQKQDDADVSRRAALALLAGATAAVG
VKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQVLRYEDN
FDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTDSEGGFESDAVATAN
ILESSAPVVGGKQYYSVTVLTRTADGDEGGKHQLITATVNDGKLYICKAQAGDKRWFKGA
RKFVESAASSFSVA
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcgtccacctcctgcttcctccaccagtccacggcccgcgtcgccgcgcgcgtcgcc
tccccgtccccggcgacacggacccacctcctcgtctgccgcgcccagaagcaggacgac
gccgacgtctcccgccgcgcggcgctcgcgctgctggccggagcgacggcggcggtgggg
gtgaaggtggcgcccgccgccgcggcctacggcgaggcggcgaacgtgttcgggaagccc
aagacgaacacggagttcatcgcctacagcggcgaggggttcaagctgctgatcccgtcc
aagtggaaccccagcaaggagcgcgagttccccggacaggtcctccgctacgaggacaac
ttcgacgccaacagcaacgtctccgtcataatcaaccccaccaccaagaagaccatcacc
gagttcggctcccccgaggagttcctcgcccaggtcgacttcttgcttggcaagcaggcc
tactccggcaagacagattccgagggtgggtttgagtcggacgcggtggcgacggcgaac
atcctggagagctcggcgccggtggtgggagggaagcagtactacagcgtaacggtgctg
acgaggacggcggacggcgacgagggcggcaagcaccagctgatcacggccaccgtcaac
gacggcaagctgtacatctgcaaggcgcaggccggcgacaagaggtggttcaagggcgcc
aggaagttcgtcgagagcgcagccagctccttcagcgtcgcatga

DBGET integrated database retrieval system