KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0158500-00
Entry
Os07t0158500-00   CDS       T02163                                 

Gene name
Os07g0158500
Definition
(RAP-DB) Similar to HAP2 subunit of HAP complex.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os07t0158500-00 (Os07g0158500)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os07t0158500-00 (Os07g0158500)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os07t0158500-00
Position
chr07:complement(join(3130094..3130514,3128920..3129038,3128751..3128819,3128432..3128575,3127907..3128293))
AA seq 379 aa
FAFLGCGFKLPSFSSLSWKNFPFLQAALSFQDHGHGLQAITGRGGNGGAAAHALPWWAGA
GAGAGSQTLLGTGGGEESFCQLSNTIMEDTRILQNHHHQILAAGRQLQQRHHFPAMPPER
HHHPPPPAPGSPAMKFPIISGDSDLGKDLKFHESSAPTIAAYSPLQEYQGHFELALGHSM
VCTNFCNSEQSYGVYSPYGAQTMAGRMLLPPAIATDVGPIYVNAKQFNGIIRRRLARAKA
EREHRVSRSRKPYLHESRHRHAMRRARGSGGRFLNTKNASSAAAAAADAAPVSSGGGDHG
ASNKSSSASEATRVYDDDDDMGAGGGGDGGDFHHAMGHLRSPAFFPSLAAMMDGGGGGGE
GKWATATPHHGCRVDLLKV
NT seq 1140 nt   +upstreamnt  +downstreamnt
tttgctttcttgggctgtggtttcaaacttccaagcttttcttccctctcatggaagaat
tttccgttcttgcaggcagctctgagcttccaagatcacggccatgggcttcaggcgatc
accggccgtggcggcaatggcggcgccgccgctcacgcattgccatggtgggctggagcc
ggagccggagctggatcccaaacactgcttggaacaggaggaggagaagaatcattctgc
caattaagcaacacaatcatggaggacacccgaatcctgcaaaaccaccaccaccagatc
ctcgccgccggccggcagctgcagcagcgccaccacttcccggcaatgccgccggagcga
caccaccaccctcctcctccagctcctggaagccctgccatgaagttcccaatcatctca
ggtgactctgatcttggcaaagatctgaagttccatgagtcctccgcgccgaccatcgcc
gcgtactcgccattgcaggagtaccaaggacactttgagctagcccttggccactccatg
gtttgcaccaacttctgcaactctgaacaaagctatggtgtttactccccctatggagct
caaaccatggctgggaggatgctgctgccgccggcgatcgccaccgacgtgggtccgatc
tacgtcaacgcgaagcagttcaacggcatcatccggcggcggctggcgcgcgccaaggcg
gagcgggagcaccgggtttcccggagccggaagccgtacctccacgagtcgcgccaccgc
cacgccatgcgccgcgcgcggggcagcggcggccgcttcctcaacaccaagaacgcctcc
tccgccgccgccgcggccgccgacgcggcgccggtgagctccggtggcggcgaccacggg
gcgagcaacaagagctcgtcggcgtcggaggcgacgcgcgtgtacgacgacgacgacgac
atgggcgcgggcggcggcggcgacggcggcgacttccaccacgcgatgggtcacctccgc
tcgccggcgttcttcccgtcgctggccgcgatgatggacggcggcggcggcggcggcgag
gggaagtgggcgaccgcgacgcctcaccatggctgccgcgtcgacctcctcaaggtgtga

DBGET integrated database retrieval system