KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0227800-00
Entry
Os07t0227800-00   CDS       T02163                                 

Gene name
Os07g0227800
Definition
(RAP-DB) Similar to ubiquinone biosynthesis protein ubiB.
  KO
K08869  aarF domain-containing kinase
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dosa01001]
    Os07t0227800-00 (Os07g0227800)
Protein kinases [BR:dosa01001]
 Serine/threonine kinases: Other
  ABC1 family
   Os07t0227800-00 (Os07g0227800)
SSDB
Motif
Pfam: ABC1 MecA_N TRCF
Other DBs
RAP-DB: Os07t0227800-00
Position
chr07:complement(join(7157798..7158005,7157527..7157643,7156975..7157117,7156555..7156668,7155975..7156163,7155739..7155894,7154535..7154800,7154323..7154420,7153958..7154136,7153429..7153539,7153067..7153246))
AA seq 586 aa
CSLSLSLHASHARHEVGDASRDVIVVPDSGEPRTHGGGGREGRRRGPLPARPPPPPPPRA
PPPPPPPPPGSPPRVGRRIRASREKGRRVGIRVFARYSQAQDFSTRLQDRAGELPKLVED
LLQTSISTGPRGAFRFAQGIQAVLGVGGEWLNDFSKTANTSAGIPAQMQLGLLSPLYLRR
LFERMGATYIKLGQFVASAPTLFPAEYVEEFQNCFDRAPPVPYSEIESILREELQQPLDS
VYEYIDPVPIASASIAQVHGARLKSSQKDVVIKVLKPGIEDTLVADLNFIYVVARILEFL
NPELQRTSLVGIVKDIKESMLEEVDFRKEAMNIEAFQRYIDAMGFDRQAKAPFVYRHCST
KRVLTMERLYGVPLTDLDSIRSLVPDPELTLVTALNVWFGSLISCESFHADVHAGNLWLL
RDGRVGFLDFGIVGRISPRTWAAMEVFLASFATDDYNAMASALSEMGATGNDINVNEFAK
DLEKIFSSIQDLDTEVIVATARTPDATAVSANVVVDERQMNALFLDLVRVSESYGLKFPR
EFALLMKQLLYFDRYTRLLAPSMNMLRDERVNISSRQQARRVDRFQ
NT seq 1761 nt   +upstreamnt  +downstreamnt
tgctctctctctctctctcttcacgcttcccacgcgcgacacgaggttggagacgcgtcc
cgtgacgtcatcgtcgtccccgactccggcgagccccgcacccatggcggcggcggccgc
gaggggcgccgccgcggcccgctccccgctcgtcctccaccgccacccccaccccgcgca
ccaccgccgcctccgcctcctccccctggctcgcccccgcgtgtggggaggaggatcagg
gccagccgggagaaggggcggcgggtcgggattagggttttcgcgaggtacagccaggcc
caggacttctccactcgcctccaagatagagctggcgaattgcctaagttggttgaggac
cttctacagacatcaattagcacagggccacgaggtgcttttaggtttgcccaagggatc
caagctgtccttggggttggtggggagtggctaaatgacttctcaaagacagccaacaca
tcagcaggaataccagctcagatgcagctgggtttgctttctcctctttatcttagaagg
ctttttgagcgcatgggtgcaacttatatcaagctaggtcagttcgtagcttctgcacca
actttgtttcctgcagagtatgtcgaggaattccagaactgttttgaccgtgcaccacct
gttccatatagtgagattgagtcaatattgcgtgaggagttgcaacagccgttggatagt
gtatatgaatacattgatccagttccaatagcttctgcgtcaatagcacaggttcatggg
gcaaggttgaagagctctcagaaggatgtggttatcaaggtcctcaagcctggtattgaa
gacactttggtggctgacctgaattttatctatgttgttgcacgtattttggaatttcta
aaccctgaactacagaggacatcactggtaggaattgtcaaggatataaaggaatctatg
cttgaagaagttgatttcaggaaagaggctatgaatattgaggcttttcagaggtacatc
gatgcaatgggatttgacaggcaggccaaagccccttttgtgtatcgccactgtagcaca
aagcgtgtcctaactatggaaagattgtacggtgttccactcactgaccttgattctata
aggtctcttgttcctgatcctgagctgactttagtcactgcacttaatgtctggtttgga
agcttgatttcatgtgaatccttccatgcagatgtgcatgcaggaaatttatggttgctc
cgagatggacgtgttggatttcttgattttggaattgttggccggatatcgccaaggacc
tgggctgcaatggaggtctttttggcttcatttgcaactgacgattataatgctatggca
tcagccctttctgaaatgggtgctacagggaatgatataaatgttaatgaatttgcaaag
gacttggaaaaaatattctcatcaatacaggatttggatactgaagtcatagttgcaaca
gcaagaactcctgatgctacagcagtatcggctaatgttgtcgttgacgagagacagatg
aatgcattgtttcttgatctggtgagggtcagcgagtcgtatggattgaaatttcctcgc
gaattcgctcttctgatgaagcagcttctgtattttgatcgctacacaagattgttggct
cccagcatgaacatgctgcgagatgagagggttaacattagctcccgccaacaggccaga
agagtagatcgtttccagtga

DBGET integrated database retrieval system