KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0258400-01
Entry
Os07t0258400-01   CDS       T02163                                 

Gene name
Os07g0258400, NRAMP1, BACTERIOCIDE_EFFECT_1
Definition
(RAP-DB) OsNramp1 (Integral membrane protein).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Nramp DUF3593
Other DBs
RAP-DB: Os07t0258400-01
Position
chr07:join(8966109..8966192,8967237..8967315,8967385..8967425,8967557..8967635,8967717..8967821,8968062..8968171,8968353..8968534,8968752..8968821,8968909..8969082,8969216..8969320,8969527..8969658,8969905..8970000,8970116..8970415)
AA seq 518 aa
MGVTKAEAVAGDGGKVVDDIEALADLRKEPAWKRFLSHIGPGFMVCLAYLDPGNMETDLQ
AGANHKYELLWVILIGLIFALIIQSLSANLGVVTGRHLAELCKTEYPVWVKTCLWLLAEL
AVIASDIPEVIGTGFAFNLLFHIPVWTGVLIAGSSTLLLLGLQRYGVRKLEVVVALLVFV
MAGCFFVEMSIVKPPVNEVLQGLFIPRLSGPGATGDSIALLGALVMPHNLFLHSALVLSR
NTPASAKGMKDVCRFFLFESGIALFVALLVNIAIISVSGTVCNATNLSPEDAVKCSDLTL
DSSSFLLRNVLGKSSATVYGVALLASGQSSTITGTYAGQYVMQGFLDIKMKQWLRNLMTR
SIAIVPSLIVSIIGGSSGAGRLIVIASMILSFELPFALIPLLKFSSSSNKMGENKNSIYI
VGFSWVLGFVIIGINIYFLSTKLVGWILHNALPTFANVLIGIVLFPLMLLYVVAVIYLTF
RKDTVKFVSRRELQAGDDTEKAQVATCVADEHSKEPPV
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgggggtgacgaaggcggaggcggttgccggcgacggcgggaaggtggtggacgacatc
gaggcgctcgccgatctcagaaaggagccagcatggaaaaggtttttgtcccacattgga
ccaggctttatggtctgtttggcttacctcgatcctggaaatatggagactgatctacaa
gctggtgccaatcacaaatatgagcttctttgggtgattttgattggcctgatctttgca
ctgattatacaatcattatcggctaatcttggagtggtgacagggcgccatcttgctgag
ctgtgcaagactgaatatccagtatgggtgaaaacctgcttatggctgctagcagaacta
gctgtgattgcttccgatattccagaagttataggtacaggatttgctttcaaccttttg
ttccacataccagtgtggaccggggttctcattgctggctctagcacgcttcttcttctt
ggactgcaaagatatggggtaaggaaactggaggttgtggtcgcgctattggtgtttgtc
atggcagggtgcttcttcgtggagatgagcatagtcaagcctccggttaatgaggtcctt
caaggattattcatccccaggctcagtgggcccggtgccacaggagactccattgccctt
cttggggctcttgtaatgccgcacaatctattcttgcactctgccctggtgctgtcgagg
aatacacccgcatcagcaaaaggaatgaaggatgtctgtaggttcttcctctttgagagt
gggatagctcttttcgtggctctgcttgtcaacattgcaatcatctctgtctccggcact
gtatgtaatgcaaccaacctttcaccagaagatgctgtaaaatgcagcgaccttacattg
gactcctcatccttcctcctcaggaatgtgctaggaaagtcaagtgcgacagtgtacggt
gtagcactcttggcttctggacagagctcgaccattactggcacttatgctgggcaatat
gttatgcaggggttcctagacatcaaaatgaaacagtggcttcggaacctgatgacacgc
agcattgccattgtgcctagcttaatcgtctccatcattggagggtctagtggcgccggt
cgtctcatcgtcattgcatcgatgattctatcctttgagctaccatttgctctgatccct
cttctcaagttcagcagcagcagcaacaagatgggtgaaaacaagaactccatctatatt
gttggattctcctgggtgctggggttcgtcatcatcgggataaacatctacttcctcagc
acaaagctggtcggctggatcctccacaacgcgctcccgacattcgccaacgtgctcatc
ggcatcgtgctgttcccgctcatgctgctctacgtcgtcgccgtgatctacctgacgttc
aggaaggacaccgtcaagttcgtgtctcgtcgtgagctgcaggccggcgacgacaccgag
aaagcacaggtagccacctgcgtcgccgacgagcacagcaaagagccacccgtgtag

DBGET integrated database retrieval system