KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0588700-00
Entry
Os07t0588700-00   CDS       T02163                                 

Gene name
Os07g0588700
Definition
(RAP-DB) Zinc finger, C2H2-type domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: zf-C2H2_6 zf-C2H2_4 zf-C2H2 zf-H2C2_2
Other DBs
RAP-DB: Os07t0588700-00
Position
chr07:23980557..23981237
AA seq 226 aa
MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSVAIGSDSEEEYLATSLL
MLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVCGKVYWCYQALGGHMTCHR
NLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGGHMRVHYVGGVEGGSVKEKNV
VKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEAKARMMTLP
NT seq 681 nt   +upstreamnt  +downstreamnt
atggggctaaacgagaagccattggtgcctccgttgtctccaacgccggtggacttccga
gcccatcaggtgttcccatccaagcaccacgattttgacactagcaagagtcgtaacatc
tctggtagtgtcgccatcggcagtgattctgaggaggagtacttggcgacttctctcttg
atgctcgcacatggcattcgggacgagaccaaggacatccgagggatgggagacgtaaaa
ggtgtgggtgttgacactttggagctggtgaaaccaagccaacgggcttatgagtgctcg
gtgtgtggcaaggtgtactggtgttaccaggcgttgggtgggcacatgacgtgccaccgc
aacctatttgcacaagtggtggccggtgatgagttgtcctccgataggaccatggtggtt
aaggggcacaagtgctctatctgtcgccttgagttcccatctgggcaggcgctaggagga
cacatgcgggtgcactatgtgggtggtgttgaaggaggctctgtcaaggagaagaacgtt
gtgaagaccaaggttacaggagcactgaagctagtgttgaaagactttgacctgaacgtg
cctgttgtggcaacgatggtgggagacgaggctgagagctcacattcagaggccaaagcg
cggatgatgacactcccctaa

DBGET integrated database retrieval system