KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0592600-01
Entry
Os07t0592600-01   CDS       T02163                                 

Gene name
Os07g0592600, GH3-8
Definition
(RAP-DB) Similar to Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 3) (AtGH3-3).
  KO
K14487  auxin responsive GH3 gene family
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    Os07t0592600-01 (Os07g0592600)
SSDB
Motif
Pfam: GH3 AIG2_2
Other DBs
RAP-DB: Os07t0592600-01
Oryzabase: 7349
Position
chr07:complement(join(24151474..24151916,24150005..24151379))
AA seq 605 aa
MAVMTDVSTTGTALRTPAAGAVKEGDVEKLRFIDEMTTNVDAVQERVLGEILGRNAGTEY
LTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPILSTHPVSEFLTSSGTSAG
ERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVL
TSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYAQMVCGLCQRNDVLRLGAVFASG
LLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREAVAAILLPDPELAKLIRAECSKGDW
AGIITRVWPNTKYLDVIVTGAMAQYIPTLEFYSGGLPMACTMYASSECYFGLNLRPMCDP
SEVSYTIMPNMGYFEFLPVDETGAASGDATQLVDLARVEVGREYELVITTYAGLNRYRVG
DVLRVTGFHNAAPQFRFVRRKNVLLSIESDKTDEAELQRAVERASALLRPHGASVVEYTS
QACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVADGSIGPL
EIRVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIVELLDSRVVSSHFSPALPHWTP
ARRSE
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcggtgatgactgatgtgtcgaccaccgggacggcactccggaccccggcggcgggg
gcggtgaaggagggcgacgtcgagaagctccggttcatcgacgagatgaccaccaacgtc
gacgccgtgcaggagcgcgtcctgggggagatcctcggccgcaacgccggcacggagtac
ctgaccaagtgcggcctcgacggcgccaccgaccgcgccgccttccgggccaaggttccg
gtggtgtcgtacgacgacctgcagccgtacatccagcgcattgcgaacggggaccgctcg
ccgatcctgtccacccaccccgtctccgagttcctcaccagctccggcacgtcggccggc
gagcgcaagctgatgcccaccatcatggacgagctcgaccgccgtcagctgctctacagc
ctcctcatgccggtcatgaacttgtatgtgcctgggcttgacaaggggaaggggctctac
ttcctgttcgtcaagtcggagacgaagacgccgggaggcctgacggcgaggcccgtgctg
acgagctactacaagagcgaccacttcaagaaccggccgtacgacccgtaccacaactac
acgagcccgacggcggccatcctctgcgccgacgcgttccagagcatgtacgcgcagatg
gtgtgcggcctgtgccagcgcaacgacgtgctgcgcctcggcgccgtgttcgcctccggc
ctcctccgggccatccgcttcctccagctcaactgggagcagctcgccgacgacatcgag
tccggcgagctcacccctcgcgtcaccgacccgtcggtgcgcgaggctgtcgccgccatc
ctcctcccggaccccgagctcgccaagctcatccgcgccgagtgctccaagggcgactgg
gccggcatcatcacccgcgtgtggccgaacaccaagtacctcgacgtcatcgtcaccggc
gcgatggcgcagtacatcccgaccctggagttctacagcggcgggcttcccatggcgtgc
accatgtacgcgtcatccgagtgctacttcggcctcaacctccgccccatgtgcgacccc
tccgaggtgtcctacaccatcatgcctaacatgggctacttcgagttcctccccgtggac
gagaccggcgcggcttcgggcgacgccacccagctcgtggacctcgcccgcgtggaggtg
gggcgcgagtacgagctggtgatcaccacctacgccgggctgaaccggtaccgcgtcggc
gacgtcctccgcgtgacggggttccacaacgcggcgccgcagttcaggttcgtgcgccgc
aagaacgtgctcctctccatcgagtccgacaagaccgacgaggccgagctgcagcgcgcc
gtggagcgcgcgtcggcgctgctccgcccgcacggcgcgtccgtggtggagtacaccagc
caagcgtgcaccaagcgcatcccgggccactacgtcatctactgggagctcctgaccaag
ggcgccggcgccacggtggtggacgcggacacgctgggcaggtgctgcctcgagatggag
gaggcgctgaacacggtgtacaggcagagccgcgtcgcggacggctcgattgggccgctc
gagatccgggtcgtccgcccgggcacattcgaggagctcatggactacgccatctcccgc
ggcgcgtccatcaaccagtacaaggtgccacgctgcgtcacgttcccgcccatcgtcgag
ctgctcgactcgcgcgtcgtgtccagccacttcagcccggcgctcccacactggactccg
gcgcgacggtccgaatag

DBGET integrated database retrieval system