KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0606600-01
Entry
Os07t0606600-01   CDS       T02163                                 

Gene name
Os07g0606600
Definition
(RAP-DB) Similar to Nuclear factor Y transcription factor subunit B homolog.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os07t0606600-01 (Os07g0606600)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os07t0606600-01 (Os07g0606600)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP
Other DBs
RAP-DB: Os07t0606600-01
Position
chr07:complement(24921249..24921923)
AA seq 224 aa
MPDSDNESGGPSNAGEYASAREQDRFLPIANVSRIMKRALPANAKISKDAKETVQECVSE
FISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIDPLKLYLHKFRELEGEKAIGA
AGSGGGGAASSGGSGSGSGSHHHQDASRNNGGYGMYGGGGGMIMMMGQPMYGSPPASSAG
YAQPPPPHHHHHQMVMGGKGAYGHGGGGGGGPSPSSGYGRQDRL
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccggattcggacaacgagtcaggggggccgagcaacgcgggggagtacgcgtcggcg
agggagcaggacaggttcctgccgatcgcgaacgtgagcaggatcatgaagagggcgctc
ccggcgaacgccaagatcagcaaggacgccaaggagacggtgcaggagtgcgtctcggag
ttcatctccttcatcaccggcgaggcctccgacaagtgccagcgggagaagcgcaagacc
atcaacggcgacgacctcctctgggcgatgaccacgctcggcttcgaggactacatcgac
ccgctcaagctctacctccacaagttccgcgagctcgagggcgagaaggccatcggcgcc
gccggcagcggcggcggtggcgccgcctcctccggcggctccggctccggctccggctcg
caccaccaccaggatgcttcccggaacaatggcggatacggcatgtacggcggcggcggc
ggcatgatcatgatgatgggacagcctatgtacggctcgccgccggcgtcgtcagctggg
tacgcgcagccgccgccgccccaccaccaccaccaccagatggtgatgggagggaaaggt
gcgtatggccatggcggcggcggcggcggcgggccctccccgtcgtcgggatacggccgg
caagacaggctatga

DBGET integrated database retrieval system