KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0608200-01
Entry
Os07t0608200-01   CDS       T02163                                 

Gene name
Os07g0608200
Definition
(RAP-DB) Similar to CCAAT-binding transcription factor subunit B (CBF-B) (NF-Y protein chain A) (NF-YA) (CAAT-box DNA binding protein subunit A). Splice isoform Short.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os07t0608200-01 (Os07g0608200)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os07t0608200-01 (Os07g0608200)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os07t0608200-01
Position
chr07:complement(join(24999670..24999726,24999426..24999576,24998671..24998777,24998521..24998589,24997787..24997954,24997046..24997408))
AA seq 304 aa
MLMLLRQMEDHRAHTTPNYDFFSGDYQMKQLGHKMYDQDSPSSDSGQSHQEESAMNDSSP
NERHTSTQSDNDDGHQMPDQDKTKSVSSLGNPGALPPKLNYSQSFACIPYTADAYYGGVL
TGYSSHAIVHPQQNGTANSRVPLPVEPAAEEPIFVNAKQYHAILRRRQIRAKLEAQNKLV
KGRKPYLHESRHRHAMKRARGSGGRFLNTKQLEEQKQQQEEEAASGGASSGNRTCLQNGT
GSAPSASSPSEIASVSTSREFLGNHEQSHFPSAGFLPTMSFRAQNGGDGKLVANAIHQRV
SMMR
NT seq 915 nt   +upstreamnt  +downstreamnt
atgctaatgcttttgcgacaaatggaagatcatcgagcccatactacgcccaactatgat
tttttctctggagattatcagatgaagcagttaggtcataagatgtatgatcaagattcc
ccgtcaagcgattctggacagtcacaccaagaagaatctgccatgaatgatagcagtcca
aatgagcgacatacctcaacacaatctgacaatgatgatggtcatcagatgccagatcag
gacaaaacaaagtcagtatcatcgttggggaatccaggagctttgcctccaaagctcaac
tatagccaatcctttgcttgtattccttatacagctgatgcatactatggtggggtcttg
actggatattcttcacatgcaattgttcatccccagcaaaatggtacagctaactcccgg
gtgccgttgcctgttgagcctgcagcagaagagccaatatttgtaaacgcaaagcagtac
catgcaattcttaggaggagacagatacgagctaaattggaggcccaaaataagttggtg
aaaggtcggaagccatacctccatgaatctcggcatcgccatgccatgaagcgagctcgt
ggatctggagggcgcttcctcaacacaaagcagctcgaggagcagaagcagcaacaggag
gaggaggccgcatccggtggcgcgagctctggcaataggacatgccttcagaatggcacc
ggtagcgcgccttcagcttcctctccctctgaaatcgcgagcgtctcaaccagcagagaa
ttccttggtaaccatgagcagagccacttcccctcagctggcttccttcccacaatgagc
ttcagagcgcagaatggcggagatgggaagctggtcgcgaacgccattcaccagcgcgtt
tccatgatgaggtga

DBGET integrated database retrieval system