KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0621500-01Help
Entry
Os07t0621500-01   CDS       T02163                                 

Gene name
Os07g0621500
Definition
(RAP-DB) Similar to predicted protein.
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Os07t0621500-01 (Os07g0621500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dosa03041]
    Os07t0621500-01 (Os07g0621500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Os07t0621500-01 (Os07g0621500)
Spliceosome [BR:dosa03041]
 Complex C
  Other components
   Step II factors
    Os07t0621500-01 (Os07g0621500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 RRM_1 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 zf-RING_2 gp37_C Secretin_N
Motif
Other DBs
RAP-DB: Os07t0621500-01
Position
chr07:complement(join(25685364..25688013,25683515..25684728))
AA seq 1287 aa AA seqDB search
YVPDISEEASFNTVPNHLRGSCATASYVYDVVKMVSIIHKNEEEGAILAFLTSQLEVEWA
CENFSDADAVVLPMHGKLSHVEQSLVFKSYPGKRKIIFCTNIAETSLTIKEVKYVVDSGL
AKESRFVPSSGLNVLKVNWISQSSANQRAGRAGRTGAGRCYRLYSESDFSMMEVHQEPEI
RKVHLGTAVLRILALGIRDAQNFEFVDAPNPEAINMAVKNLEQLGAVKYKCDGFELTDTG
RYLVKLGIEPRLGKIMLDCFGFGLRKEGVVLAAVMANSSSIFCRVGTDEEKYKADRLKVP
FCHQDGDLFTLLAVYKEWEDEHENRNTWCWQNSINAKTMRRCQETISDLENCLRHELNII
VPSYWCWNPEESTVHDKLLKRIILTSLSGNIAMFSGHERFGYQVISTDQAVKLHPSCSLL
IYDSKPEWVVFTEILSVPNQYLVCVTAIDPDALCSIHPMPLIQQLEKLKLQVKVISGLGY
NLLRKFCGKSGQNQQKIISLLQEEFRDDRVTVEVDFRNKEVVLFAKEQDIEKVFGIVNDA
LECEARMLRNECLEKSLFSGKPGDCSLALFGSGAEIKHLELEKRYLTVEVLHQNAHELND
KELICLVDTLISGVANFYKLYGNLQVASDETKWGKFTFLNPEYAEDAVSKLNGMEFHGSP
LKVVPVCSSSNRGLPFPAVRAKVSWPLKQSRGLALVTCASGEAEFVVKDCFALGVGGRYI
NCEVSTRHENCIFVRGIPMHVTEPELYDAFRSTTTRKIVDVHLLRGTPIAAPSASLCAEA
LNREISSFMPKKIFPAQNFRVEVLTPEENDSVMRATITFDGSLHREAARALEHLQGSVLP
CCLPWQTIQCQHVFHSTVSCQVRVYNVISQAVASLLESFRSQKGVSYNLEKNEYGIFRVK
LTANATKTIADLRRPLEILMKGKTINHPDLTLSTVQLLMSRDGVADLKSVEQETGTYILY
DRQSLNIKVFGLQDQVAAAEEKLIHALLQLRDKKPLDIRLRGRNLPPNLMKEMLKKFGAD
LEGLKREVPAVELRLNLRQHTLYVRGSKEDKQRVEEMISELVNSTKYNGLLQLPLENACP
ICLCEVEDPFKLESCGHVFCLTCLVDQCESALKSHDGFPLCCLKNGCKKQLLVVDLRSLL
SSEKLEELFRASLRAFVASNAGKYRFCPTPDCPSIYQVAAADAESKPFVCGACFVEICNK
CHLEYHPFISCEAYKEYKEDPDATLLEWRKGKENVKVCPSCHFTIEKADGCNHVECKCGS
HICWACLENFRSSDDCYSHLRSVHLSY
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
tatgtccctgatatatcagaagaggcttccttcaataccgtgccaaaccatctgcgcggt
tcttgtgctactgcttcatatgtttacgatgttgtgaaaatggtaagcatcattcacaag
aatgaagaagagggtgctatccttgctttcttgacttctcaactcgaagttgaatgggca
tgtgaaaacttcagcgatgcagatgctgtggtacttccgatgcatggaaagctttcccat
gtagagcaaagtctagttttcaagagctatcctgggaagagaaaaataatcttctgcaca
aatattgctgaaacatcattgaccataaaagaagtgaagtatgttgttgattctggactg
gctaaggagagcagatttgtgcctagcagtggtctcaatgtactgaaagttaattggatc
tcccaaagttctgctaatcagcgtgctggccgagcaggtcgaactggagcggggaggtgt
tacaggctttactctgaatctgacttcagtatgatggaagtgcatcaagaacctgaaatc
cgcaaagttcatcttggcactgctgttctgagaatacttgcgctgggtattagggatgca
cagaattttgaatttgttgatgccccaaacccagaagctattaatatggctgtaaagaat
cttgaacaactgggtgctgtaaaatataaatgtgatggttttgagctgactgatactggt
cgctacctagttaaattgggaatcgagccgaggcttgggaaaatcatgcttgattgcttt
ggttttggtttgaggaaggaaggtgtagttctagctgctgttatggcaaattctagcagc
atattttgtagagtgggcacagatgaggagaaatacaaagctgaccgtctaaaggtccca
ttctgtcatcaggatggagatctgttcactttactagctgtatataaagagtgggaggat
gagcatgaaaacaggaatacgtggtgctggcagaatagcatcaatgccaagaccatgagg
aggtgccaggaaacaatatcagaccttgagaattgtttaagacacgagctgaacatcatt
gtcccaagttactggtgttggaaccctgaggagtccaccgtgcatgataagttgctaaaa
agaattattctcacatctctttctggtaatattgctatgttttctggacatgaaaggttt
ggttaccaggtgatttcaacggatcaggctgtgaaactacatccctcttgctcattgctc
atttatgatagcaagcctgagtgggtggtgttcacagaaatcttgtcagtaccaaatcaa
tatttggtatgtgtaactgctattgatcctgatgctttgtgttcgattcaccccatgcct
ttgattcagcaactggagaagcttaaattgcaggtgaaggtaataagtggacttggatat
aacttgctgagaaaattttgtggaaaatctggccaaaatcagcagaagataatctcactt
ctccaagaagaattcagggatgaccgtgtgactgttgaagttgacttcagaaataaagag
gttgtgctatttgccaaagaacaagacatagaaaaggtgtttggcatcgttaatgatgca
ttggagtgtgaagctcggatgttgaggaatgaatgccttgagaaaagtttgttttctgga
aaacctggtgattgttctcttgccctatttggttctggtgctgaaataaagcatttggaa
cttgagaagaggtatctgaccgtagaggttttgcatcaaaatgctcatgagttgaatgac
aaggagcttatttgcttggtggatactcttatctctggtgttgctaatttttataaactt
tatggaaatcttcaggtggcctcagatgaaacgaagtgggggaagtttacattcctcaat
cctgaatatgctgaagatgctgtttcaaaattgaatgggatggaatttcatggttctcca
ttgaaagtggttccagtatgctcttccagtaatcgaggattaccatttccagcagtgaga
gctaaagtatcttggccacttaagcaaagtcggggactcgcgctggtaacatgtgccagt
ggggaagctgaatttgttgtaaaggactgctttgctctgggagttggtggaaggtatatc
aactgtgaggttagtacaagacatgagaattgcatttttgtcagaggaattccaatgcat
gtaacagagccagaattgtatgatgcctttcgtagcacgacaacaaggaaaatcgttgat
gtgcatttgctcaggggaacacccatagctgccccttctgcttccttgtgtgcagaagca
ctaaatagagaaatttcttccttcatgccaaagaaaatttttcctgcccaaaatttccgt
gttgaggtgttaactccagaggagaatgattcggtgatgagagccactattacttttgat
ggaagtcttcatcgagaggctgcaagagcattggaacatcttcaaggaagtgttcttcca
tgctgtcttccttggcagacaatacaatgccagcatgtgtttcatagtactgtgtcctgt
caagtacgcgtgtataatgttatcagccaagcagttgcttctcttcttgagagcttccga
agccaaaaaggcgtgtcttacaatttggaaaagaatgaatatggtatattccgtgtcaag
cttactgcaaacgccacaaaaacaatagcagacttgagaaggcctcttgagattttaatg
aaaggcaaaacaataaaccatcctgatctgacactaagtacagttcagttgctcatgtcc
cgtgatggtgtagcagatttgaaatctgttgagcaagagactggcacttacattctgtat
gacagacaaagtctaaatattaaagtctttggactccaagatcaggttgctgcagcagag
gagaaattgatccatgcccttctacaactccgtgataagaaacctttggatattcgtctt
cgtggccgtaacctacctccaaacttgatgaaggaaatgttaaaaaagttcggggctgat
ctggaaggattgaagagagaggtgcctgcagtagagcttcgattaaatttacgacaacat
acactttacgttcgaggcagtaaagaagacaagcaaagggtggaagaaatgatctctgag
ctggtaaattctacaaagtacaatggcctgcttcaacttccattagagaatgcatgccct
atttgcctgtgtgaggtagaagatccctttaagcttgaatcttgtgggcatgtgttttgt
ctgacttgcttggtggatcagtgtgaatctgctttgaaatcacatgatggtttccctctg
tgttgcctcaaaaatgggtgcaagaagcagctccttgttgttgatttgagatctctccta
tcgagcgagaaactggaagagctatttagagcctccttgagagcatttgttgcttctaat
gcaggaaaatatcgtttctgtcctactcctgattgcccatccatttaccaagtggctgct
gcagatgctgaaagcaaaccttttgtctgtggggcttgctttgtggagatctgcaacaag
tgtcatcttgaatatcatcctttcatatcctgtgaggcatacaaagaatacaaggaagac
cctgatgcaactctgcttgaatggcgcaaggggaaggagaatgtgaaggtatgcccttct
tgccactttacaatcgagaaagctgatggttgcaaccatgtcgagtgtaaatgtggcagt
cacatttgttgggcatgcttggagaacttcaggagcagtgatgattgttatagccatctc
aggtctgtgcacctatcctattaa

DBGET integrated database retrieval system