KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0671700-01
Entry
Os07t0671700-01   CDS       T02163                                 

Gene name
Os07g0671700
Definition
(RAP-DB) Similar to Arginine methyltransferase-like protein.
  KO
K05931  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os07t0671700-01 (Os07g0671700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     Os07t0671700-01 (Os07g0671700)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     Os07t0671700-01 (Os07g0671700)
SSDB
Motif
Pfam: PrmA Methyltransf_25 Methyltransf_11 MTS PRMT5 Methyltransf_23 Met_10 RrnaAD FtsJ Methyltransf_32 Cons_hypoth95 Methyltransf_9 Methyltransf_18 DREV Methyltransf_24
Other DBs
RAP-DB: Os07t0671700-01
Position
chr07:join(28402475..28402678,28402841..28402912,28403736..28403844,28404551..28404694,28404791..28404894,28404979..28405077,28405160..28405229,28405705..28405801,28406021..28406075,28407085..28407168,28407429..28407506,28407605..28407708,28407790..28407962,28408056..28408213,28408889..28408924)
AA seq 528 aa
MASPDLFPNVSFSHVSVPAAAGASTEVTGGATAVFGGDASTGAPRLSLVWSGETQAKHTL
EIDLSDAQIFKLGPTEWLCVSGESEAKDGVEEKSYSRAIKVVLRTEAESKAFYLAFQQWK
HRVISGKAGEPLENGLIIGSKSKFDTKIEASSAKMYFHYYGQLLHQQNMLQDFVRTGTYY
AAVMENRSDFEGRVVVDVGAGSGILSLFAAQAGARHVYAVEASEMAEHAQRLISGNPSLG
QRITVIKGKVEEVELPEKADILISEPMGTLLVNERMLESYVIARDRFLVPGGKMFPTTGR
IHMAPFSDEYLYVEMANKALFWQQHNFFGVDLTPLHGSAFQGYFSQPVVDAFDPRLLVSP
PTFHTLDFTTMKEEELYEIDIPLNFVASVGTRVHGLACWFDVLFNGSTVQRWLTTAPGSP
TTHWYQLRCILSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGEGAEQGGILQT
STAKLELKEPYYRLSQPQPYVMQQDQQQQQLPSLQPQSPLWDYHYGQD
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggcgtcgccggacctgttcccgaacgtctccttctcccatgtctccgtccccgccgcc
gcgggcgcgtcgacggaggtcaccggcggcgccacggccgtgttcggcggggacgcgtcc
accggggccccgcgcctcagcctcgtctggtccggggagacccaggcgaagcacacgctc
gagatcgatctctctgacgcgcagatatttaagctggggccgacggagtggctgtgcgtg
agcggcgagtcggaggctaaggacggtgtggaggagaagtcatattcaagagcaattaag
gttgttcttaggacagaagctgagagcaaagccttctatttagcttttcaacaatggaaa
caccgagtgattagtggaaaagctggtgaacctttggaaaatggattaataattggttct
aaaagcaaatttgatacaaaaattgaggcctcatcagcaaagatgtatttccactactat
ggccagttattacatcagcaaaatatgttgcaagactttgtcaggacaggaacatactat
gctgctgtaatggaaaatcgatccgattttgagggtcgagttgtggttgatgttggagct
ggtagtggcattctttcattatttgctgcacaggctggtgccagacatgtatatgcagtt
gaggcatctgaaatggctgaacatgctcagcgtcttatttctggaaacccatctcttgga
caaagaataacggtcatcaaaggcaaagttgaggaagttgaacttccagagaaagctgac
atacttatttcggagcctatgggaaccctcttggtgaatgaaaggatgctggagtcctat
gttatagctagagacagattccttgtgccaggtggtaaaatgtttccaacaactggaagg
attcatatggctccattttccgatgaatacctctatgttgaaatggcaaacaaggctctc
ttctggcagcagcataacttttttggtgttgatcttacacctttgcatggttcagcattc
caggggtatttttcacagcctgtggtggatgcattcgatccaagattattggtttctccg
cctacgtttcatacgcttgatttcactaccatgaaggaagaggagctttacgagattgac
attcccctaaattttgtggcctctgttggcactagggtgcatgggctagcttgttggttt
gatgtattgttcaatgggagcactgtccagaggtggcttaccactgctccaggctcccct
acgactcactggtatcaactacgatgcatactttcacagccattatatgtcatggcagga
caagaaataacaggacgacttcatctggtagcccacagtgcacaaagctacacgatatac
ttgacgatgtcagctaaaatgtggggtgagggggcagaacaaggtggcatcctgcagaca
tccacagccaaacttgaactcaaggagccatactacaggctgtctcaaccacaaccatat
gtgatgcaacaagaccagcagcagcagcagttaccatctttgcagccacagagtcctctc
tgggactatcactacggacaagattag

DBGET integrated database retrieval system