KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0675100-01Help
Entry
Os07t0675100-01   CDS       T02163                                 

Gene name
Os07g0675100
Definition
(RAP-DB) Similar to Pectin methylesterase isoform alpha (EC 3.1.1.11) (Fragment).
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00040  Pentose and glucuronate interconversions
dosa01100  Metabolic pathways
Module
dosa_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os07t0675100-01 (Os07g0675100)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os07t0675100-01 (Os07g0675100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
RAP-DB: Os07t0675100-01
Position
chr07:complement(join(28561843..28562887,28559310..28560004))
AA seq 579 aa AA seqDB search
MPPPRTKHRPLLLATTFLSLLLLLLLLSLLSTAHKAFAVADDDGHRARVLLAADGGERNA
DAEHAAAVDRHCAGTLHRDVCVSTLSTIPNLARKPLRDVISEVVGRAASAVRASSSNCTS
YLQRPRQLRTRDRLALSDCLELFGHTLDLLGTAAAELSAGNSTAEESAAGVQTVLSAAMT
NQYTCLDGFAGPSASEDGRVRPFIQGRIYHVAHLVSNSLAMVRRLPTQRRRGAEEEPLEG
YGRVRRGFPSWVSASDRRRLQQQVAADVVVAKDGSGKFTTVSEAVAAAPNNSETRYVIYI
KAGGYFENVEVGSEKTNIMFVGDGTWKTVIKASRNVVDNSTTFRSATLAVVGTGFLARDI
TVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHSLRQFYRDCDIYGTVDFIFG
DAAVVLQNCNLYARRPDPNQKNVFTAQGREDPNQNTGIAIQGCKVAAAADLVPVQANFSS
YLGRPWKTYSRTVFLQSKIDSLIHPRGWLEWNGSFALDTLYYAEYMNRGDGADTSARVSW
PGYHVLTNATDAANFTVLNFVQGDLWLNSSSFPYILGLS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgccacctccaagaaccaagcaccggccgcttctcctcgccaccaccttcctctccctt
ctgctgctgctgctgctgctcagcttgctctccaccgcgcacaaggcattcgccgtcgct
gacgacgacggccaccgcgcgcgcgtgcttcttgcagcagacggcggcgagaggaatgcc
gatgccgagcacgcggccgccgtggaccggcattgcgccgggacgctccaccgggacgtc
tgcgtgtcgacgctgtccaccatcccgaacctcgcgcggaagccgctccgggacgtgatc
tccgaggtcgtggggcgcgccgcgtcggcggtgcgcgcgtcgtcgtccaactgcacgtcc
tacctccagcggccgcggcagctgcgcacgcgcgaccgcctcgcgctgtccgactgcctc
gagctgttcgggcacacgctggacctgctgggcacggcggccgcggagctctccgccggg
aacagcaccgccgaggagtccgccgccggcgtgcagaccgtgctgtcggcggcgatgacg
aaccagtacacctgcctcgacgggttcgccgggccgtccgcctcggaggacgggcgcgtc
cggccgttcatccagggccgcatctaccacgtcgcccacctggtctccaactcgctcgcc
atggtgcggcgcctcccgacccagcggcggcgcggggcggaggaggagccattggaaggg
tacggccgcgtgcgacgcgggttcccgtcgtgggtgtcggcgtcggaccggaggcggctg
cagcagcaggtggcggcggacgtggtggtggcgaaggacgggagcgggaagttcacgacg
gtgagcgaggcggtggcggcggcgccgaacaacagcgagacgcggtacgtgatatacatc
aaggccggcgggtacttcgagaacgtggaggtcgggagcgagaagaccaacatcatgttc
gtcggcgacggcacgtggaagaccgtcatcaaggccagccgcaacgtcgtcgacaactcc
accaccttccgctctgccacgctcgccgtggtgggcacggggtttctggcgcgggacata
acggtggagaacgcggcggggccgagcaagcaccaggcggtggcgctgcgggtgaacgcc
gacctgtcggcgttctaccggtgcagcttcgcgggctaccaggacacgctgtacgcgcac
tcgcttcgccagttctaccgcgactgcgacatctacggcacggtggacttcatcttcggc
gacgccgccgtcgtgctccagaactgcaacctctacgcgcgccgcccggaccccaaccag
aagaatgtgttcacggcgcagggccgggaggaccccaaccagaacaccggcatcgccatc
cagggctgcaaggtcgccgccgccgccgacctcgtccccgtccaggccaacttctcctcc
tacctcggccgcccgtggaagacctactcgcgcacggtgttcctgcagtccaagatcgac
agcctgatacaccccagggggtggctcgagtggaacggcagcttcgcgctcgacacgctc
tactacgccgagtacatgaaccgcggcgacggcgccgacacgtcggcgagggtgtcgtgg
ccggggtaccacgtgctcaccaacgccaccgacgcggccaacttcaccgtgctcaacttc
gtgcagggtgacctctggctcaactccagctcgttcccctacatcttggggttgagctga

DBGET integrated database retrieval system