KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0104900-01
Entry
Os08t0104900-01   CDS       T02163                                 

Symbol
Os08g0104900
Name
(RAP-DB) Protein of unknown function DUF6, transmembrane domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: TPT EamA UAA TMEM234
Other DBs
RAP-DB: Os08t0104900-01
Position
chr08:complement(join(271579..271689,270109..270358,269767..269974,269393..269624,269097..269309))
AA seq 337 aa
MEEAKMGDVATIRAVLAILQWWGFNVTVIIMNKWIFQKLEFKFPLTVSCVHFICSSIGAY
IAIKILKMKPLIEVAPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATT
VILQWLVWRKYFEWRIWASLVPIVGGIMLTSITELSFNMFGFCAAMVGCLATSTKTILAE
SLLHGYKFDSINTVYYMAPFATMILSVPAIVLEGSGVINWLYTYDSIVPALIIITTSGVL
AFCLNFSIFYVIHSTTAVTFNVAGNLKVAVAVLVSWMIFRNPISAMNAVGCAITLVGCTF
YGYVRHLISQQSVNSSPRTPRSRMEMLPLVGDKQEKI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaggaagccaagatgggagacgttgccaccatccgagccgttctggcgatcctccaa
tggtggggcttcaacgtcaccgtcatcatcatgaacaaatggatcttccagaaattggag
ttcaagttccctcttactgtctcgtgtgtccactttatatgctcttcgattggagcttac
atcgcaatcaaaattctcaagatgaaaccactgattgaagttgccccagaggatcggtgg
agaagaatattcccaatgtcatttgtgttctgcataaacattgtactgggaaatgtcagc
ctgagatatattccagtctccttcatgcagaccataaaatctttcacccctgcaacgaca
gttattctgcagtggttggtctggaggaagtatttcgagtggcgcatatgggcttctctg
gtaccaatagtgggaggaatcatgttaacatcaataactgagcttagtttcaacatgttt
ggtttttgtgctgctatggttggttgcctggcaacatctaccaagaccatccttgcagag
tctctactccatggatacaaatttgatagcattaacactgtgtactacatggcgccattt
gcaaccatgatactgtcagtaccagcgattgtgctggaagggagtggcgtcatcaattgg
ctctacacgtatgattccatcgtccctgcactgatcatcatcaccacctccggagtactc
gcattttgcctcaacttctccatcttctacgtcatccattccacaacggctgtcaccttt
aacgtagccggcaacctgaaagttgctgtggctgtgttggtgtcgtggatgatcttccgg
aacccgatctccgcgatgaacgctgtcgggtgcgcaatcacgctcgtcggctgcaccttc
tatggctatgtgaggcatctcatctcgcagcagagcgttaattcgagcccacgcacgccg
aggagccggatggagatgcttcccctcgtaggagacaagcaagagaagatttaa

DBGET integrated database retrieval system