KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0116500-01
Entry
Os08t0116500-01   CDS       T02163                                 

Gene name
Os08g0116500
Definition
(RAP-DB) Similar to 60S acidic ribosomal protein P1 (L12).
  KO
K02942  large subunit ribosomal protein LP1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Os08t0116500-01 (Os08g0116500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dosa03011]
    Os08t0116500-01 (Os08g0116500)
Ribosome [BR:dosa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Os08t0116500-01 (Os08g0116500)
SSDB
Motif
Pfam: Ribosomal_60s
Other DBs
RAP-DB: Os08t0116500-01
Position
chr08:join(904315..904383,904493..904616,905156..905241,905341..905394)
AA seq 110 aa
MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLEHRSVDDLIL
SVGSGGGAAPVAAAAAPAAGGGAAAAPAAEEKKEEAKEESDDDMGFSLFD
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcgtccagcgaggtcgcctgcacgctcgccgccctcatcctccacgacgatggcatc
cccatcacctctgagaagatcgccaccctggtgaaggcggccaacatcaaggtcgaggcc
tactggcccggtctcttcgccaagctcctcgagcaccgcagcgtcgatgacctcatcctc
tccgtcggatctggtggtggtgctgctccagttgctgctgctgctgcccctgctgctggc
ggtggtgctgctgctgccccagctgccgaggagaagaaggaggaggcgaaggaggagagc
gacgatgacatgggtttcagcttgttcgactaa

DBGET integrated database retrieval system