KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0157900-01
Entry
Os08t0157900-01   CDS       T02163                                 

Gene name
Os08g0157900
Definition
(RAP-DB) Similar to NAM protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: NAM ZirS_C
Other DBs
RAP-DB: Os08t0157900-01
Position
chr08:complement(join(3393072..3393240,3392104..3392390,3391519..3391845,3391092..3391388,3390183..3391007,3389862..3389931,3389559..3389773))
AA seq 729 aa
MTVMELKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSL
IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSKGDKKKQQVIGMKKTL
VFHRGRAPKGERTGWIMHEYRTTEPEFESGEQGGYVLYRLFRKQEEKIERPSPDEVDRSG
YSPTPSRSTPDNMEPIEDGNTPLNRESPESALHESPIDLPALTEAQAAPITRWLADRTDN
ATTNEVNISHMPHHGLDGGAKASPSAGAFPQLIGSQQNIHDNNELATVSAPMLPHEDFNN
FPLGAIGNFDGNMNPRDPVEEFLNQTIADPDEHSSTTSKAQYDSDTGIIPTEFENHGVMQ
GEFMDDLSGLENLDFWPDDRNPQLSALYEDTPLLPYDSTDQDVLSMDSGAESLQDLFNSM
DDSNARNNVWGNEPFLQGTGFPMSWPLQPNSAFPNQGTANRRLMLQLSESLSPDFDVSMT
RDECEDEEPGIVVTSKYVNEAPEESTAEKDMPSDGDDAEPTGITILRRRHAPTASSFSDG
DDAESTGITILRQHQAPNASLLSDGDDAESTGITILRRRQAPTASSASSFTQQGAAVQRV
RLQSNLDAAPCSSVDGSSSCIINEGESERTMEKPEIEENAGSTLAEGGTCHEDDQKEHDA
SAANAKSVLRLRKTAEGSDKENKQEEEEGVLASHVRAPGNKRGFPSYIIWLVLSVALVLL
ISLGIYGWV
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgacggtgatggagctcaagaagctgccgctcgggttcaggttccaccccaccgacgag
gagctcgtcaggcactacctcaaggggaagatcacggggcagatcaggagcgaggccgat
gtcatccccgagatcgatgtctgcaagtgcgagccgtgggatctccctgataagtctctg
atccgctccgatgatccggagtggttcttcttcgcgccgaaggataggaagtatcccaat
gggagcaggtcgaacagggcgacggaggccgggtactggaaggccaccgggaaggacagg
gtgatcaggtccaagggtgacaagaagaagcagcaagtaattggcatgaagaagacgctc
gtgttccaccgggggcgtgcgccgaagggtgagcggactgggtggatcatgcatgagtac
cgcaccaccgagccggagtttgagtccggtgagcagggaggttacgttctctaccggctg
ttccgaaagcaagaggagaaaattgagcgacccagtccggatgaagtggatagaagtgga
tactcacccactccttctcgttcaactcctgataacatggaaccaattgaagacggaaat
acaccattaaacagggaatctccagaatctgctctgcatgaaagcccaattgatttgcct
gctctaactgaggctcaagctgcgccaattacaaggtggcttgcagacagaactgataac
gcgacaacaaatgaagtaaacatctctcacatgcctcatcatgggcttgatggaggagct
aaggctagcccttcagctggtgctttccctcagctgattggttcacaacagaatatccat
gataataatgaattagccacagtttctgcacccatgctaccacatgaagacttcaataat
ttccctctaggagccattggtaattttgatggcaatatgaatcctcgagatccagtggag
gagttcttgaatcaaaccattgctgatccagatgagcattcatcaacaacatcaaaggct
cagtatgattcggacactggaatcataccaactgagtttgagaaccatggggtgatgcag
ggtgaattcatggatgatctgagtgggttggaaaatttagatttctggccagatgaccga
aatccccagttgagtgcactgtatgaggacacaccattgctgccttatgatagcaccgac
caggatgtgctctccatggactctggtgctgaatccttgcaagatctattcaacagcatg
gacgattcaaacgcgaggaataatgtatggggcaacgaaccattcctccaggggactgga
tttcccatgtcttggccgttacagccgaactccgcatttccaaaccagggcactgcaaat
aggaggctcatgctacagctatcagaatcattatctcctgattttgatgtgagcatgact
agagatgagtgtgaagatgaggaaccaggtattgttgtaacttcgaagtatgtgaatgaa
gctcctgaggagtcaactgcagaaaaggatatgccttctgatggagatgatgctgagcca
acgggtattactatcctgaggcgacgccatgctccaactgcaagttcgttttctgatgga
gatgatgctgagtcaacgggtattaccatcctaagacagcaccaagctccaaatgcaagc
ttgctttctgatggagatgatgctgagtcaacgggtatcactatcctaagacgacgccaa
gctccaactgctagctcagctagttcatttactcaacagggtgctgcagtgcaaagggtg
cggctacaatcaaaccttgatgcagcaccgtgttctagcgttgatggttcatcaagttgc
atcataaatgaaggtgaaagtgaacgcaccatggagaaacctgagattgaagagaatgca
ggaagtaccttggctgaaggtgggacttgccatgaggatgaccagaaggagcatgatgct
tcagcagcaaatgctaaatctgttctgaggctgcggaagacagcagagggaagcgacaag
gagaacaagcaggaggaagaggagggtgttcttgcttcacatgtgagagcaccagggaat
aagaggggattcccatcgtacatcatttggctggttctctctgtggctctggtcctgctt
atctcccttgggatttatggatgggtgtaa

DBGET integrated database retrieval system