KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0196700-01
Entry
Os08t0196700-01   CDS       T02163                                 

Gene name
Os08g0196700
Definition
(RAP-DB) Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os08t0196700-01 (Os08g0196700)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os08t0196700-01 (Os08g0196700)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os08t0196700-01
Position
chr08:join(5598730..5598837,5599080..5599151,5599226..5599390,5600562..5600798)
AA seq 193 aa
MKPDGETQLRPTAAGHPDPGLGTSSAEYVASLGPATAPVSYPYISTYYGGTYGAYSGQPL
VNAALMAMPPHSVPLVTDAVVEPIYVNARQYHGILRRRQSRAKAESENKANKIRKPYLHE
SRHLHALKRARGSGGRFLNSKAVEGKQDTKSVDKKDGAVPSEEKRDKKLANSIIKLENSS
PTTQPGADASDVV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgaagccagatggtgaaactcagcttcgtcctacagctgctggacatccagatcctggt
ttgggcacatcatctgcagaatacgtggcctctctaggaccagctacagctccagtatct
tatccatatatcagtacctattatggaggcacttatggtgcttatagtggacaacctctg
gttaacgctgctttaatggcaatgcctccgcattctgtgcccttggtgaccgatgctgtt
gtagagcccatatatgtcaatgcaaggcagtatcatggtatattaaggcggcgccaatct
cgtgcaaaagctgaatcagaaaataaggccaacaaaatccgcaagccttacctacatgag
tcccgccatctgcatgctttgaaaagggcaagggggtccggtggtcgatttctcaactct
aaggctgtggaggggaagcaagacactaaatctgtagataaaaaggatggagctgtgcca
tctgaggagaagagagacaagaagttggcaaatagcattatcaaattggagaactcgagc
ccaacaacacaaccaggtgcagatgcgtccgatgttgtatga

DBGET integrated database retrieval system