KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0206500-00
Entry
Os08t0206500-00   CDS       T02163                                 

Gene name
Os08g0206500
Definition
(RAP-DB) Similar to HAP5 subunit of HAP complex.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os08t0206500-00 (Os08g0206500)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os08t0206500-00 (Os08g0206500)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone Condensation RNA_pol_Rpo13
Other DBs
RAP-DB: Os08t0206500-00
Position
chr08:complement(join(6217053..6217326,6212073..6212647))
AA seq 282 aa
MESKSAYGGAIGVWTPMRESWGSASAVTSARPFVTNNVIPAIWSRIAPSLPPSPLPRRPR
SALAHCRASPASVSPSARASPTPPSPRSPPHQHQQHAIQQVQQLQQQQKEQLQAFWADQM
AEVEQMTEFKLPNLPLARIKKIMKADEDVKMIAGEAPALFAKACEMFILDMTLRSWQHTE
EGRRRTLQRSDVEAVIKKTDIFDFLVDIITDDKMKDDGMGSQAASMVSPYTSGGMGFSFD
LYPNQHHLAYMWPPQEQQEQWPPQEQQEQKQKQDSDGGGQDE
NT seq 849 nt   +upstreamnt  +downstreamnt
atggagtccaagtcggcgtacggcggcgccatcggagtgtggacaccgatgagggagtca
tggggctccgcatcggcagtgacatcggcaagaccctttgtcaccaacaacgtcatccca
gccatctggtctcgaatcgcgccatcactgcctccgtcaccccttccgcgccgacctcgt
tccgcgctcgcccactgccgcgcctctcccgcctcggtctctccctctgcccgcgcctcc
ccgacgccaccctcgccgcgctcaccgccgcaccagcatcagcagcacgcaatccagcaa
gttcagcagctccagcagcagcagaaggagcagctccaggcgttctgggccgaccagatg
gccgaggttgaacagatgactgagttcaagctccccaacctcccgcttgcaaggatcaag
aagatcatgaaggccgatgaggacgtcaagatgatcgcgggcgaggcaccggcgctcttc
gccaaggcctgcgagatgttcatcctggacatgacgctgcggtcctggcagcacaccgag
gagggcaggaggaggacgctgcagaggagcgacgtcgaggcggtgatcaagaagaccgac
atcttcgatttcttggtggatatcatcactgatgataagatgaaggatgatggcatgggc
tctcaggctgcatccatggtttcgccatatacctcaggaggaatgggattttcctttgat
ctgtacccgaaccagcatcacctcgcatatatgtggcctccacaagagcagcaggagcag
tggcctccacaggagcagcaggagcagaagcagaagcaggattctgatggtggtggacaa
gatgaatga

DBGET integrated database retrieval system