KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0223900-00
Entry
Os08t0223900-00   CDS       T02163                                 

Gene name
Os08g0223900
Definition
(RAP-DB) Similar to Cycloartenol synthase (EC 5.4.99.8) (Fragment).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement
Other DBs
RAP-DB: Os08t0223900-00
Position
chr08:join(7540132..7540326,7540576..7540761,7540884..7540973,7541091..7541288,7541626..7541710,7542101..7542267,7542592..7542780,7543525..7543638,7543733..7543852,7543932..7544054,7544559..7544657,7545077..7545133,7545614..7545660,7545733..7545876,7546370..7546547,7547005..7547085,7547268..7547351,7547758..7547958)
AA seq 785 aa
MWKLKIAEGGPWLKSGNSHVGRETWEFDPNFGTSEEREAVEAARIEFQKNRFRTRHTSDV
LARMQLAKANNFSIDLQKEKDGNPINIDTATVSDILKKALSYFSAIQAYDGHWPGDFPGP
LFTTATMIIVLYVTESLTITLSSEHHKEICRYLYNRQNIDGGWGLHAEGESSMLSTALNY
TALRLLGENVDDGPDISMHKARKWIHDHGGATMIPILGKVWLSVLGVFDWSGVNPIPPEL
FLLPSFVPIQPGRLWSHFRMAFIPMSYLYGKKFVGPITRLVISLREELHIHPYKKIDWKE
ARKLCAKEDAYNPHMWLQECLSDCLYSFGEPFLTRWPISYMRKRALYQIAEFLKYEDENS
QYICIGAAQKALSMLCCWIENPNSDAFKRHLARVADFLWVGEDGMKVRVCAGQLWDVAFA
VQAILACSIAEEFGSTLKKAHGFIKTSQIMDNPSGDFSRKYRHISKGGWAFQVADQGWQV
SDCTAEALKALLLLSKCLSDGADYQMETYCYFDAVNVLLSLQNPNGGYGAWELARTYPWM
EIFNMTEIYADIIVEHQYVECTSSVIQALALFREKYPGHRKDEIDQCIRKATEFIEKLQN
DDGSWFGSWGICFTYGTWFAIEGLSAVGQCYDDSTCIRKACKFLLSKQLTNGGWGESHLS
SRTKAYTNLDGEKSHIVNTAWAMLALMKAGQVERDPAPLHKAARLIMSMQLSDGDFPQEE
MIGSFLKNGPLCYMAYRNIFPIWALGEYQKLVFQNYQTSSIKQTNIAPSAGNAALKNSAS
TTAPT
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgtggaagctcaagattgccgagggaggaccatggctaaagagtggaaacagtcatgtt
ggaagagaaacatgggaatttgacccaaattttggaacaagtgaagagcgggaggcggtt
gaggctgcacggatagagttccagaagaataggttcagaacaagacacacctccgatgtt
ttggctcgcatgcagttagctaaggcgaacaacttcagtattgatctacagaaagaaaaa
gatggaaaccccataaatattgacacagctacagtatcagatatactgaagaaggcactc
agttatttctcagccatacaggcatatgatgggcactggccaggggatttcccaggccca
ctgtttaccactgcaaccatgatcatagttctatatgtcacagagtcattaactattaca
ctgtcatcggaacatcacaaggagatctgtcgatatctgtacaatcgtcagaacatcgat
ggaggatggggactacatgcagaaggtgaaagttccatgcttagcacagctctcaattat
actgctctgagactacttggggagaatgttgatgatggaccagatatatccatgcataaa
gcaagaaaatggatacatgaccatggaggtgcaacaatgataccgatcttgggaaaagtg
tggctctcggtgcttggagtttttgactggtcaggtgtaaatcctattcccccagaatta
tttcttcttccatctttcgttcctatccaaccaggacgattatggagtcacttccgaatg
gcttttattcccatgtcttatttgtatggaaaaaagtttgtcggtcctataacaagattg
gttatatcattaagggaagagctacatattcatccctataaaaagattgactggaaggag
gcacgcaaattatgtgcaaaggaagatgcctataatccacatatgtggctacaagagtgc
ctatctgactgcctttatagttttggtgagccgtttcttacacgttggccaatttcctac
atgagaaaaagagctctataccaaattgctgagttcttgaagtatgaagatgaaaattct
cagtatatctgcattggtgctgcacagaaggcattatccatgttgtgctgttggattgaa
aatcccaattcagatgcattcaagcgtcatttggctagagtagctgattttctatgggtt
ggcgaagatggcatgaaagttcgggtctgtgcgggtcaattatgggatgttgctttcgca
gtccaagcgatattagcgtgtagcatcgcagaagaatttggaagtacccttaagaaagca
catggtttcataaaaacttcccagattatggacaatccttctggtgacttcagcagaaag
taccgtcacatatctaaaggaggatgggccttccaggttgcagatcaggggtggcaggtt
tcagattgcacagcagaagctcttaaggctttgctactgctgtcaaagtgtttgtcagat
ggtgcagattatcaaatggaaacctactgctactttgacgcggtgaatgtattactctcg
ttacagaacccaaatggtgggtatggagcatgggagctagctcgcacatatccatggatg
gagattttcaacatgacagagatatatgcagacatcattgtggagcatcagtacgtagag
tgtacctcatcagtcatccaagcattggcattgttccgggagaagtaccctgggcatcgg
aaagatgaaatagatcaatgcatcaggaaagcaacagaattcatcgagaagttacagaat
gatgatggatcatggtttggatcatggggtatttgcttcacgtatggaacatggtttgca
atagagggtctgtcagccgtggggcagtgttatgatgacagcacctgcattcggaaagcc
tgtaagtttctgttatcaaagcaactaacaaatggtggatggggggagagtcatctttca
tccagaaccaaggcatacacaaacctagatggggagaaatcacatatagtcaatactgca
tgggcaatgttggcactcatgaaagctggacaggtagagagagaccccgctcctctgcac
aaagcagcaagacttatcatgagcatgcagctcagtgatggtgactttccacaagaggaa
atgatcggaagtttcttgaaaaatggccccttgtgttatatggcttatcgcaatatattc
ccaatatgggctcttggagagtatcagaaattagtatttcagaactatcagacctctagc
atcaagcaaacaaatatagctccatctgctggcaatgctgctctgaagaattcagcaagt
acaacagcgccaacttga

DBGET integrated database retrieval system