KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os08t0520900-00
Entry
Os08t0520900-00   CDS       T02163                                 

Gene name
Os08g0520900, ISOAMYLASE_1, ISA1
Definition
(RAP-DB) Similar to Isoamylase (Fragment).
  KO
K01214  isoamylase [EC:3.2.1.68]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os08t0520900-00 (Os08g0520900)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     Os08t0520900-00 (Os08g0520900)
SSDB
Motif
Pfam: Alpha-amylase CBM_48 GHL10
Other DBs
RAP-DB: Os08t0520900-00
Position
chr08:complement(join(25900166..25900342,25899850..25900032,25899653..25899745,25899144..25899296,25898674..25898750,25897951..25898092,25897761..25897868,25897561..25897646,25897091..25897162,25896876..25897002,25896436..25896522,25895902..25895994,25895255..25895413,25894735..25894818,25894500..25894580,25894340..25894419,25894129..25894246,25893751..25894008))
AA seq 725 aa
VEAVVMPERYALGGACRVLAGMPAPLGATALDGGVNFAVYSAGASAASLCLFTPDDLEAD
EVTEEVPLDPLFNRTGNVWHVFIEGELHNMLYGYRFDGMFAPHCGQYFDVSNVVVDPYAK
AVISRGEYGVPGPGGDCWPQMAGMIPLPYSTFDWQGDLPLRYPQKDLVIYEMHLRGFTKH
SSSNVEHPGTYIGAISKLDYLKELGVNCVELMPCHEFNELEYFSCSSKMNFWGYSTINFF
SPMIRYSSGGIRNCGRDAINEFKTFVREAHKRGIEVIMDVVFNHTAEGNEKGPILSFRGI
DNSTYYMLAPKGEFYNYSGCGNTFNCNHPVVREFIVDCLRYWVTEMHVDGFRFDLASIMT
RGCSLWDPVNVYGSPVEGDMTTTGTPLATPPLIDMISNDPILGDVKLIAEAWDAGGLYQV
GQFPHWKIWSEWNGKYRDIVRQFIKGTDGFAGGFAECLCGSPHLYQAGGRKPWHSINFVC
AHDGFTLADLVTYNKKYNSSNGEDNRDGENHNLSWNCGEEGEFAGLSVKRLRKRQMRNFF
VSLMVSQGVPMFYMGDEYGHTKGGNNNTYCHDHYVNYFRWDKKEESSDLQRFCSLMTKFR
KQCESLGLADFPTAQRLHWHGHQPGKPDWSETSRFVAFSTKDETKGEIYVAFNASHLPAV
VGLPERPGYRWEPLVDTGKPAPYDFLTDDLPDRAHAVHLFSHFLNSNLYPMLSYSSIILE
LQPDD
NT seq 2178 nt   +upstreamnt  +downstreamnt
gtggaggcggtggtgatgccggagaggtacgcgctgggtggcgcgtgcagggtgctcgcc
ggaatgcccgcgccgctcggggccaccgcgctcgacggcggggtcaatttcgccgtctac
tccgccggcgcatccgccgcgtcgctctgcctcttcacccccgacgatctcgaggcggat
gaggtgactgaggaggttccgcttgatcctctgttcaatcggacggggaatgtgtggcac
gtcttcatcgaaggcgagctgcacaacatgctgtacgggtacaggttcgatggtatgttc
gcccctcactgcggccagtacttcgatgtctccaatgtcgtggtggatccttatgccaag
gcagtgataagccgaggagagtatggtgtccccggtcctggtggcgattgctggcctcaa
atggctggcatgatccctcttccgtacagtacgtttgattggcaaggtgacctacctctg
agatatcctcagaaggatcttgtaatctatgagatgcatttacgtgggtttacaaagcac
agttcaagcaatgtagaacatccagggacttacattggggctatatcaaagcttgactat
ctgaaggagcttggagttaactgtgtagagttgatgccctgccatgaattcaatgagctg
gagtacttcagctgctcttccaagatgaacttctggggatactccacgataaactttttt
tcaccaatgataagatattcatcaggtgggataagaaactgtggccgtgatgccataaat
gaattcaaaacttttgttagagaggctcacaaacggggaattgaggtgatcatggatgtt
gtcttcaatcatacagccgagggtaatgagaaaggaccaatattatcatttagggggata
gataatagcacatactatatgcttgcccctaagggagagttttacaattattctggttgt
gggaataccttcaactgtaatcatcctgtggtccgtgaatttattgtagattgtttaaga
tactgggtgacagaaatgcatgttgatggttttcgttttgatcttgcatccataatgacc
agaggatgcagtctttgggatccagttaatgtgtatggaagtccagtagaaggtgacatg
actacgacagggacacctcttgctactccaccacttattgacatgatcagcaatgatcca
attcttggagatgtcaagctcattgctgaagcatgggatgcgggaggcctctatcaagta
ggtcaatttcctcactggaaaatttggtcagaatggaatggaaagtaccgggacattgtt
cgtcaattcattaaaggcacagatggatttgctggtggtttcgctgaatgtttgtgtgga
agtccacatctataccaggcaggggggaggaaaccttggcacagtatcaactttgtgtgt
gcgcatgatggatttacgctggctgatttggtgacatataacaagaagtacaactcttca
aatggtgaggataatagagatggagaaaatcataacctcagctggaactgtggggaggaa
ggagaatttgcaggtttgtcggtcaaaagattgaggaagaggcaaatgcgcaatttcttt
gtttctctcatggtttctcaaggtgttccgatgttctacatgggcgatgaatatggccat
acaaaaggaggcaacaacaacacatactgccatgaccattatgtcaattatttccgctgg
gacaagaaagaagaatcctctgacttgcaacggttctgctctcttatgaccaaattccgc
aaacaatgcgagtcccttggcctcgcagacttcccaacagctcaacggttgcattggcat
ggccatcagcctgggaaacctgactggtctgagacaagccgtttcgtggccttctccacg
aaagatgaaacgaaaggcgagatctacgtggccttcaacgccagccatttgccggcggtt
gttggactcccagagcgcccaggctaccgctgggagccgctggtggacacaggcaagcca
gcgccttatgacttcctcaccgacgacctgcctgatcgtgctcacgccgtccacctgttc
tctcatttcctcaactccaatctctaccccatgctcagctactcctccatcatccttgaa
ttgcagcctgatgattga

DBGET integrated database retrieval system