KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0255000-01Help
Entry
Os09t0255000-01   CDS       T02163                                 

Gene name
Os09g0255000
Definition
(RAP-DB) Similar to Cell wall invertase (EC 3.2.1.26).
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Os09t0255000-01 (Os09g0255000)
   00500 Starch and sucrose metabolism
    Os09t0255000-01 (Os09g0255000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os09t0255000-01 (Os09g0255000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
RAP-DB: Os09t0255000-01
Position
chr09:join(4165521..4165680,4165840..4165848,4168954..4170232,4170301..4170394,4170485..4170733)
AA seq 596 aa AA seqDB search
MARLGLAVCAASFHLFLLLASTSSLRRAPTEADTANHARRTAYHFQPAKNWQNDPNGPMY
HNGMYHLFYQYNPHSALWDIGNLSWGHSVSGDLLNWAALDTALDPTSPFDANGCWSGSAT
ILPGALPAILYTGIDASKEQVQNVAFAKNPSDPLLREWEKPAYNPVIALPADVPGDKFRD
PSTAWLGRDGLWRIAVSAEVDGVASTLVYRSKDFVRWERNAAPLHASRAAGMVECPDLFP
VAERGEDGLDTSANGAGGVRHVLKLSVMDTLQDYYMVGTYDDAADAFSPAEPERGDDCRS
WRRLDYGHVYASKSFFDVRKNRRVLWAWANESDSQADDVARGWSGVQTFPRKMWLAKDGK
QLLQWPIEEIKTLRRKRAGLWQGTRLGAGAVQEIVGVASSQADVEVVFKIPSLEEAERVD
DPNRLLDPQKLCGEKGAAVRGGVGPFGLLVMASGDLHEHTAVFFRVFRHHDKYKLLMCTD
LTKSSTRAGVYKPAYGGFVDMDIDDHKTISLRTLIDHSVVESFGGGGRACITARVYPEHV
ATSSSHLYVFNNGSDAVKVAKLEAWDLATATVNVVVGDHHGLVAPALELEPTRTTQ
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggcgagattaggccttgccgtctgcgccgcctccttccacctcttccttcttcttgcg
tcgacctcctcgctccggcgagctcccacggaggcggacacggccaaccatgccagaaga
actgcctatcacttccagcctgcaaagaactggcagaatgatccgaatgggcctatgtac
cataacggtatgtaccatttgttctaccagtacaacccgcatagcgcgctctgggacatc
ggcaacctctcctggggccactccgtctccggcgacctcctcaactgggccgctctcgac
accgcgctcgaccccacctcgcctttcgacgccaatggctgctggtcgggctccgccacc
atcctccccggcgccctcccggccatcctctacaccggcatcgacgccagcaaggagcag
gtccagaacgtcgccttcgccaagaacccctccgatccgctcctccgcgagtgggagaag
cccgcgtacaatccggtcatcgcgctcccggccgatgtccccggcgacaagttccgtgac
ccctcgacggcatggctcggccgtgacggcctgtggcggatcgccgtctccgccgaggtg
gacggcgtcgcgtccacgctcgtctacaggagcaaggacttcgtccggtgggagcggaac
gccgcgccgctgcacgcgtcgcgcgccgcgggcatggtggagtgcccggacctgttcccc
gtagcggagcgcggcgaggatggcctcgacacgtcggcgaacggcgccggcggcgtgcgc
cacgtcctgaagctgagcgtgatggacacgctccaggactactacatggtcggcacgtac
gacgacgcggcagacgccttctcgccggcggagcctgagcgcggcgacgactgccggagc
tggcggcggctggactacgggcacgtgtacgcgtccaagtcgttcttcgacgtgcgcaag
aaccggcgcgttctgtgggcgtgggcgaacgagtccgacagccaggccgacgacgtcgcc
cgcggctggtccggcgtgcagacattcccgaggaagatgtggctagccaaggacggcaag
cagctgctgcagtggccgatcgaggagatcaagacgctgaggaggaagcgcgccggtctc
tggcaaggcaccaggctaggcgccggcgcggtgcaggagatcgtcggcgtggcgagctcg
caggcggacgtggaggtggtgttcaagattccgagcctggaggaggccgagagggtggac
gaccccaaccggctgctggatccccagaagctgtgcggtgagaagggcgccgccgtgcgg
ggcggcgtcggcccgttcgggctcctcgtaatggcctccggcgacctgcacgagcacacc
gccgtcttcttcagggtgttcaggcaccatgacaagtacaagcttcttatgtgcaccgac
ttgacaaagtcgtcgacaagagcaggggtgtacaagccggcttacggcggattcgtggac
atggacatcgacgatcacaaaaccatatcgctgagaacgttgattgaccattcggtggtg
gagagcttcggcggcggcgggcgggcgtgcatcacggcgcgggtttacccggagcacgtg
gcgacgagcagcagccatttgtacgtgttcaacaacgggagcgacgccgttaaggtggcc
aagctggaggcgtgggacctggcgacggcgaccgtcaacgttgttgttggagaccaccac
ggccttgttgcgccggcgttggagttggagccgacacgcacgacgcagtga

DBGET integrated database retrieval system