KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0286400-01
Entry
Os09t0286400-01   CDS       T02163                                 

Gene name
Os09g0286400
Definition
(RAP-DB) Sodium/hydrogen exchanger subfamily protein.
  KO
K14724  solute carrier family 9 (sodium/hydrogen exchanger), member 8
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dosa02000]
    Os09t0286400-01 (Os09g0286400)
Transporters [BR:dosa02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   Os09t0286400-01 (Os09g0286400)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
RAP-DB: Os09t0286400-01
Position
chr09:complement(join(6383222..6383438,6381430..6381481,6381181..6381240,6381060..6381084,6380899..6380984,6380709..6380820,6379155..6379217,6379048..6379067,6378878..6378975,6378366..6378394,6377876..6377907,6377726..6377773,6377591..6377651,6377387..6377484,6377226..6377301,6377109..6377128,6376271..6376368,6376079..6376188,6375572..6375649,6375165..6375262,6374999..6375081,6374750..6374793))
AA seq 535 aa
MALELSLVSASPPGGLAASPPPPAAIPGKEQQVAGVGILLQISMLVLSFVLGHVLRRHRF
YYLPEASASLLIGLVVGGLANISNTETNTRMWFNFHDEFFFLFLLPPIIFQSGFSLSPKP
FFANFGAIVTFAILGTFIASVVTGVLVYLGGLTFLMYKLPFVECLMFGALISATDPVTVL
SIFQELGTDVNLYALVFGESVLNDAMAISLYRTMSLVRSQAAAGENFFMMVFQFLETFVG
SLSSGVGVGFISALLFKYAGLDIDNLQNLECCLFVLFPYFSYMLAEGLGLSGIVSILFTG
MVMKHYTFSNLSNNSQRFVSAFFHLLSSLAETFVFIYMGFDIAMEEHSWSHVGFIFFSII
FIIIARAVNVFSCAYLVNMSRPEHRRIPLKHQKALWFSGLRGAMAFALALQSANELPGGH
GKTIFTTTTAIVVLTVLLIGGSTGTMLEALDVIGDENRSIENYDDNNGYIPPTYEEGSSS
GGGLRMKLKEFHKSTTSFTALDRNYLTPFFTSQTDEDDDVFGEQPQNQRRGFYDQ
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcgctggagctgagcctggtgtccgcttcgccccctggtgggctggcggcgagcccg
cccccgcccgccgccatcccggggaaggagcagcaggtggccggggtggggatcctgctg
cagatctccatgctcgtgctctccttcgtgctcggccacgtcctccgccgccaccggttc
tactacctccccgaggccagcgcgtctctcctcatcggtctagttgtcggtgggcttgct
aatatttcaaatacagagaccaacactaggatgtggttcaacttccatgacgaatttttc
ttcttgttcttattgcctccaataatattccaatcaggattcagtctatccccaaaacca
ttctttgcaaattttggggctattgtaacttttgccatccttgggacattcattgcttct
gttgtaacaggagttctcgtctatcttggtgggttgacatttctaatgtacaaacttcca
tttgttgagtgcctcatgttcggtgctcttatatctgcaactgatcctgtcactgtgtta
tcaatattccaggagctgggcactgatgttaacttgtatgctcttgtgtttggagaatct
gttctaaatgatgcgatggcgatttcgctttacaggacaatgtcattggtcagaagtcaa
gcagcagctggggagaacttctttatgatggttttccagttccttgagacctttgttggt
tcattgtcatcaggtgttggagttggatttatctctgctcttctgtttaagtatgctgga
ctggatattgacaatcttcaaaacttggagtgctgcctttttgttctcttcccatacttc
tcgtatatgttagcagaaggacttgggttgtcaggaattgtttccatactattcacagga
atggttatgaagcactatacattttccaatctctcaaacaactctcagcgcttcgtttct
gccttctttcacttgctgtcatctttagcagaaacatttgtgttcatttatatgggcttt
gatattgccatggaagaacatagctggtctcatgtgggcttcatattcttctcaattata
tttataatcattgcaagggcagtaaatgtcttttcttgtgcatatttggttaacatgtca
cggccagaacatcgacgcatacctctaaagcatcagaaagcactttggtttagtgggctt
agaggggccatggcttttgcacttgctctccaatctgccaatgaacttcctggaggacat
ggaaaaacaatattcacaaccaccacagctattgttgttttaacggtacttcttatcgga
ggatcgacgggcaccatgctggaagctttggatgtaattggtgatgaaaacagatcaata
gaaaattatgacgacaacaatggttacatccccccaacgtatgaggaaggttcatcatct
ggaggaggattaagaatgaaactgaaggaattccacaaaagcacgacatcgttcactgcc
cttgacaggaactatctgactccatttttcaccagtcaaactgatgaggatgatgatgtc
ttcggtgaacaaccccaaaaccagagacgcggattctatgaccaatag

DBGET integrated database retrieval system