KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0444500-01
Entry
Os09t0444500-01   CDS       T02163                                 

Gene name
Os09g0444500
Definition
(RAP-DB) Similar to Protein Brevis radix-like 1.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Other DBs
RAP-DB: Os09t0444500-01
Position
chr09:16552997..16553233
AA seq 78 aa
MLTCIACSKQPGGGGGEPLHEPPEDEDAVDGGGGGGGATPSTRLAIKALTAQVGFSVLHS
RESRLSLCVLEALLFLSC
NT seq 237 nt   +upstreamnt  +downstreamnt
atgctcacgtgcatcgcgtgctcgaagcagcccggcggcggcggcggggagccgctgcac
gagccgccggaggacgaggacgccgtcgatggcggcggcggcggcggcggggcgacgccc
agcacgcggctggccatcaaggcgctcactgcgcaggtggggttctcggtacttcactct
cgagagtcgagactgtcactgtgtgtgcttgaagctcttcttttcttatcctgttga

DBGET integrated database retrieval system