KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0481700-01
Entry
Os09t0481700-01   CDS       T02163                                 

Gene name
Os09g0481700, WRKY_GENE_90, WRKY90
Definition
(RAP-DB) SUSIBA2-like (WRKY transcription factor 80).
  KO
K18835  WRKY transcription factor 2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    Os09t0481700-01 (Os09g0481700)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os09t0481700-01 (Os09g0481700)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  Other transcription factors
   WRKY
    Os09t0481700-01 (Os09g0481700)
SSDB
Motif
Pfam: WRKY Bac_luciferase
Other DBs
RAP-DB: Os09t0481700-01
Position
chr09:complement(join(18499445..18499900,18498856..18499026,18498158..18498696,18497883..18498077,18497222..18497762))
AA seq 633 aa
MASSSDHGSLMEDWMPPPTPSPRTLMSSFLNEDFVSGSFSNIFSDHESNKPQDQFERNRE
LVDLSKEVPSQFARPAFQRDASLDHSLVSPTQRSNSHGGLAERRAARAGFSVPKIDTSRG
GSSTVIRSPVAIPPGLSPTTLLESPVFLYNAMAQPSPTTGTLPFLMASNAKSTIPSATKM
DEDCTFGNDTFSFQPHVGSRRPNFSAAEKGPNACHQNQSLSNIHQRESSLQSSFTAVKDI
TDEKNIKTKTSDSMFGDNHSSDEQDDETNQNGENSMPPPNHRSGVPLSHTNDPEVNVLEN
RGSQTCHNSASLWDNAKNDCLQDVQSEVIETRTAACLPVSTNCDTSIMESQDAVDVSSTL
SNEEDDRATHGTASIECNGDGDETDSKRRKLDALTAATAAITTTSNIDMGAAASRGVREP
RVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCSVRKHVERASHDLKSV
ITTYEGKHNHEVPAARNSGHGSSGSGNAPSAPQSNGSQRRQEQGQASFSQFGGAAPFSSF
VLPPRNQFGPSASNFPFGMVPPGMAIPMPSLGSLAPAKMAGHPSTMQGYQGLMIPEGEMK
TEPMSQLGFPAVNQSSSSFQQMMNRPPSFGPQM
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggccagcagtagcgaccatggatccctcatggaggactggatgccaccacccacaccc
agcccgagaacactcatgtcaagcttcttgaatgaagattttgtctctggttcattttcc
aatattttcagtgatcatgagagcaacaaaccccaggatcagtttgagagaaacagagag
cttgtggatttgagtaaggaagtgccttcccaattcgcaagacccgcattccagagggat
gcttccctggatcatagcttggtcagtcctacacagagatcaaactcgcatggtggtttg
gcagagcgcagggctgcgagggctggtttcagtgtcccgaaaatcgatacatcccgtggt
ggttcatccacagtaattcgatcgcccgtggcaattccaccaggtcttagtccaacaaca
cttctcgagtcaccggttttcctttacaacgcaatggcacagccttctccaaccactggc
acactgccatttttgatggcttcaaatgctaagtcaacaataccgtcagctaccaagatg
gacgaagattgcacatttggcaatgacactttctccttccaaccgcatgtagggtcgaga
cggccaaatttctccgctgcagaaaagggtcccaatgcttgtcaccaaaaccaatcgctg
tcgaatatccatcagcgggaatccagtcttcagtcaagctttactgcagtcaaagatatc
actgatgaaaaaaacattaaaacaaagacatctgactccatgtttggtgataaccactct
tctgatgaacaagatgatgagactaaccaaaatggagaaaactctatgccacctccgaac
caccgttcaggtgtccctctgtcacataccaatgatccagaagtgaatgtcctagagaac
cgcggttcacagacatgccataactctgcatccttgtgggacaatgccaaaaatgattgc
cttcaagatgttcaaagtgaagttattgaaacaagaacagctgcttgtcttccagtatca
accaattgtgatacatctatcatggagtcccaagatgcagttgatgtgtcgtcaacacta
tctaatgaggaggatgatagggcaacgcatggcacggcttctatagagtgcaacggggat
ggagatgagactgattccaagagaaggaagctggatgctttgacagctgcaactgctgct
attaccaccaccagtaacattgacatgggagctgcggcatcgagaggtgtccgggagcct
cgtgttgttgttcagacaacaagtgaggttgacatccttgatgacggttaccgctggcgc
aagtatggacagaaggttgttaaaggaaatccaaacccaaggagctattacaaatgtacg
caccaagggtgttcggtgcgcaagcacgtggagagagcatcgcatgatctaaaatccgtc
atcacgacgtacgaggggaagcacaaccatgaagttccagctgccagaaatagtggacat
gggagctctggatctggaaacgctccatctgcaccgcaatctaacggctctcagcgcagg
caagaacaagggcaagccagcttcagccagtttggtggcgcggctcccttcagctccttc
gttctcccaccaagaaaccaatttggaccatcggcgagcaatttcccctttgggatggtc
ccgccaggcatggcgattcccatgccatctctagggtctcttgctccagcaaagatggct
ggtcatccatccaccatgcagggctaccaggggctcatgattccggaaggagagatgaag
acagagcccatgtcgcagctcggcttccccgcggtaaaccaatcttcatcatccttccaa
cagatgatgaacaggcctccatcatttggacctcagatgtaa

DBGET integrated database retrieval system