KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0529300-01
Entry
Os09t0529300-01   CDS       T02163                                 

Gene name
Os09g0529300
Definition
(RAP-DB) Similar to Leaf angle-associated protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Other DBs
RAP-DB: Os09t0529300-01
Position
chr09:complement(20733547..20734467)
AA seq 306 aa
MSSIAPSMRTRVRIPGYLSFMYHMFCCSHVVNSCFFSSIFFPDGVAMEEKEDSLRASVTE
QDTEALLLRDVLINGILAIGTLGHNVNSLCPESCIEQDEPIIMCDEKVEQEKCEEEKAEA
KQDTPVTAPSEPASALEPAKMHSSSMKEDNFMCFVKEEILMHGMEVEDVPNIQERPLLML
EKVEKVRTTLADLFAAEAFSSSDAEDKCYPKIVIVAGASTSKPTSCMEKMHHKKPTKPTS
KPLKATRKLSRVWFSSSLLYLLSLVTLYFTSLEFITLCSMVSAPHLTHMFYHIATTGVSI
MHLASL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtcgagtattgcaccatcaatgagaacaagggtaaggataccaggatatctctctttt
atgtaccacatgttttgttgttctcatgttgtcaactcttgtttcttctcttctattttt
tttcctgatggagtagccatggaagagaaggaagactctctgcgtgcaagtgtgactgag
caagacactgaggccctgctgctccgtgatgtgcttattaatggtatacttgcaattggc
acgctgggccacaatgtaaactcactctgtcctgagtcctgtattgaacaagatgagccc
atcatcatgtgtgatgagaaagtggaacaagagaagtgcgaagaagaaaaggctgaggct
aaacaggacacaccagttacagcaccaagtgaaccggcatctgctcttgagcctgccaag
atgcactcatcatcgatgaaagaagacaacttcatgtgctttgtgaaggaggaaatccta
atgcatggcatggaagtggaagatgttcctaacatccaggaacgaccacttctgatgtta
gagaaggtggagaaagtgagaactacacttgccgatctatttgctgcagaagcattctca
tcaagtgatgcagaggataagtgttacccgaaaatcgtcattgttgctggggcatccact
tcaaagcctacgtcgtgcatggagaagatgcatcacaagaagccaacaaaaccaacgtca
aagccgctgaaggctacaagaaaattaagtcgagtatggttttcttcgtctctgctttat
ttgttaagccttgttacattatattttactagtctggaatttattacactttgttccatg
gtcagtgcgccacatcttacacatatgttttaccatatagctacaactggagtaagcatt
atgcatctagccagtctttag

DBGET integrated database retrieval system