KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0529700-01
Entry
Os09t0529700-01   CDS       T02163                                 

Gene name
Os09g0529700
Definition
(RAP-DB) Similar to EAP30 family protein.
  KO
K12188  ESCRT-II complex subunit VPS22
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Os09t0529700-01 (Os09g0529700)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os09t0529700-01 (Os09g0529700)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dosa04147]
    Os09t0529700-01 (Os09g0529700)
Membrane trafficking [BR:dosa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    Os09t0529700-01 (Os09g0529700)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os09t0529700-01 (Os09g0529700)
SSDB
Motif
Pfam: EAP30 DUF773 DUF3631
Other DBs
RAP-DB: Os09t0529700-01
Position
chr09:complement(join(20747279..20747329,20747078..20747188,20746387..20746522,20746127..20746282,20745856..20745962,20745476..20745565,20745079..20745186))
AA seq 252 aa
MRRRPGIAGLQNAAATRDQFRLVGENVAKVRTDVMKEQLATFRTQLEEFARKHKNDIRKN
PLFRQQFHEMCAKVGVDPLASNKGAWAELLGIGDFYYELGVQIVDICIATRATNGGLIDL
LDLRKLLCQKRKADLGSLTSDDCLRAISKLKVLGSGFEVISVGKKKLVRSVPTELNKDHN
GILELAQAEGFVTVEQVERKFSWSTGRAIDVLETLLKEGLAMIDDGHRDGKRRYWFPCVT
LSSDSTGADAKS
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaggaggcgaccgggaatcgcgggcttgcagaacgcagcggctactcgtgaccaattc
cggctggttggggaaaatgtggccaaggtcaggaccgatgtcatgaaggagcagcttgcg
acgtttcggacacagctcgaagaatttgcacgcaagcataagaatgatatccgtaaaaat
ccactatttagacaacagttccatgagatgtgtgcaaaagttggagtagacccgctggct
tcgaataaaggagcttgggcagagcttctagggattggtgacttctactatgaattggga
gttcagattgttgacatatgcatagcaaccagagcgaccaacggtggcttgattgacttg
ctagatctccgtaaactcctctgtcagaagaggaaagctgatcttggatcgttaacatca
gatgattgtttgcgtgcgataagtaagctgaaggtccttggtagtggttttgaagtaatt
tctgttgggaagaaaaagcttgtgcgttctgttcctacagaactgaataaagatcacaat
gggatacttgagctagctcaggctgaaggttttgtcaccgtagagcaagtcgagagaaag
ttctcgtggtcaactggccgtgccattgacgtccttgaaactttgctcaaggaagggctt
gcgatgatcgacgatgggcacagggatggcaagcgcagatactggttcccgtgcgtcact
ctcagctctgactctactggtgcggatgccaagtcatga

DBGET integrated database retrieval system