KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os09t0565600-01
Entry
Os09t0565600-01   CDS       T02163                                 

Gene name
Os09g0565600
Definition
(RAP-DB) Similar to Delta(14)-sterol reductase (EC 1.3.1.70) (C-14 sterol reductase) (Sterol C14-reductase) (FACKEL protein).
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00100  Steroid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    Os09t0565600-01 (Os09g0565600)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     Os09t0565600-01 (Os09g0565600)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
RAP-DB: Os09t0565600-01
Position
chr09:join(22536682..22536729,22536813..22536930,22537023..22537093,22537194..22537250,22537666..22537757,22537999..22538046,22538792..22538912,22538991..22539037,22539191..22539272,22539487..22539563,22539668..22539787,22540259..22540333,22540413..22540566)
AA seq 369 aa
MDAAAVAASLVPSWSAVLVLFSYLGYLAAAGAVLPGKLVPGAVLPDSSRLHYRCNGLLSL
LLLLVLSALGVYMGWMSPTVIADRGIELLSTTFIFSVIVTFLLYYSGLRSHHKSSSLKPH
ITGNFIQDWWLGVQLNPHFMGVDLKFFFVRAGMMAWLFINLSLFAKSYLAGSANLSVILY
QFFCAWYIVDYFVHEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLRNKVELS
LLAAVVNCFIFVIGYLVFRGANKQKHIFKKNPKALIWGKPPKLVGGKLLVSGYWGIARHC
NYLGDILLALSFSLPCGTSSVIPYFYPTYLFILLIWRERRDEARCSEKYKEIWVEYCKLV
PWRIFPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacgccgccgcagtcgccgcctcgctggtgccctcgtggagcgcggtgttggtgctc
ttctcctacctaggctacctcgccgccgccggcgccgtcctccccggcaagctcgtcccc
ggagccgtcctcccggactcgtcccgcctccactaccgctgcaacggtttgctctcgctc
ctcctcttgctggtgctctccgcgctcggtgtctacatgggatggatgtcccctacggtc
attgctgaccgtggaatcgagctgttgtctacaaccttcatttttagtgttattgttacc
ttcttactgtattattcaggattaaggtcccatcataaaagttcttccttgaaaccgcat
atcactgggaacttcatacaagattggtggttgggagtgcagctcaatcctcatttcatg
ggagttgacctcaagttcttttttgtgagagctgggatgatggcatggttatttatcaac
ctatctttgtttgcaaagagctacctagctggttcagccaatctttcagtcattctctac
caattcttttgtgcgtggtatattgtagattacttcgttcatgaagaattcatgacttca
acatgggacattattgcggaaaggctgggtttcatgctggtctttggtgatctagtgttc
attccatttaccttcaccattcagggatggtggcttttgagaaacaaagtggagctgtcc
cttttggctgctgtagttaactgcttcattttcgttattggctatcttgtgttcagagga
gccaacaaacaaaaacatatcttcaagaagaaccctaaagctcttatttggggtaaacct
cccaaacttgtcggggggaagctacttgtatctggctactggggaattgcaaggcactgc
aattatcttggggatatactgctagctctttcatttagcttaccctgtggaaccagttcg
gtgatcccatacttctacccaacatacctgttcattttgctgatatggagggaacgaagg
gacgaagcaaggtgctcagagaagtacaaggagatctgggtagaatattgcaagcttgtg
ccttggaggatctttccttacgtgtattaa

DBGET integrated database retrieval system