KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0191900-00
Entry
Os10t0191900-00   CDS       T02163                                 

Gene name
Os10g0191900
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os10t0191900-00 (Os10g0191900)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os10t0191900-00 (Os10g0191900)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-X
Other DBs
RAP-DB: Os10t0191900-00
Position
chr10:6404506..6405513
AA seq 335 aa
MPIPEKDGVEDNQEDDTFSRLQLLAQQRHAMEKFWRMSQEQIEESAGNEELILPISRVKN
IIHAKEGGMMLSADTPAFVTKLCELFVQELILRAWVCANSHNREIILGTDIAEAITTTES
YHFLANVVHGHQALGSNIPEIGVSAWKRHKLDEMTSLCHPPQAVQVTDLANHPPNIPVCP
PIGQSGTQHTTSTHVLMMQGESIHKASKEKSPLKEVMVPTNKVGMTNSSYGVPNGGGATS
SKVVIDSPKGETAQVFSSQHACPSLEDNYVIPIPAGHGDSFRTLDEANIPQLHQEQKNFI
SQDAIVGENIPLNESLEKSKHKDEDLLFPDKDLPE
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgccgatcccggaaaaggacggggtggaggacaatcaagaggatgatacattttcaagg
ttgcaattgcttgcacaacaacgacatgccatggagaagttctggaggatgagccaggaa
cagatcgaagaatccgcaggcaacgaagagcttatactgccgatttcccgtgtcaagaat
atcatccatgcaaaggagggtggtatgatgttatctgctgataccccagcttttgtaaca
aaactttgtgaacttttcgtccaggagctcatccttcgtgcttgggtgtgcgccaactca
cacaatcgtgaaatcatacttggcacagatattgctgaggcaatcaccaccacagaatcc
tatcactttcttgctaatgtagtccatggccaccaggcgctaggaagcaacataccagag
ataggggtttctgcttggaagcgccataagctagatgaaatgacctcactctgccatcct
ccccaagcagtgcaggtcacagatttagctaaccatccacccaatattcctgtttgtcct
cctataggtcaatcgggtactcagcacacaacatctacacatgttttgatgatgcaagga
gaatctattcacaaggcaagtaaagaaaaatccccactgaaggaagtgatggtgccgacc
aacaaggtgggcatgaccaacagctcttatggagttcctaatggtggtggtgctactagt
agtaaagttgttattgatagcccgaaaggcgaaacagcacaagttttctcttcccagcat
gcatgtccttccctagaagataactatgttattcccattcctgctggacatggtgatagt
tttcgtactcttgatgaggccaatataccccagctacatcaggagcagaaaaactttatt
tcacaagatgctattgttggtgaaaacattccgctgaatgagtctttggaaaagagcaag
cataaggatgaggacttactttttcctgacaaagatcttcctgagtga

DBGET integrated database retrieval system