KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0317900-01Help
Entry
Os10t0317900-01   CDS       T02163                                 

Gene name
Os10g0317900
Definition
(RAP-DB) Similar to Flavonoid 3'-monooxygenase (EC 1.14.13.21) (Flavonoid 3'-hydroxylase) (Cytochrome P450 75B2).
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00941  Flavonoid biosynthesis
dosa00944  Flavone and flavonol biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os10t0317900-01 (Os10g0317900)
   00944 Flavone and flavonol biosynthesis
    Os10t0317900-01 (Os10g0317900)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os10t0317900-01 (Os10g0317900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     Os10t0317900-01 (Os10g0317900)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP75 family
   Os10t0317900-01 (Os10g0317900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
RAP-DB: Os10t0317900-01
Position
chr10:join(8494368..8495330,8503289..8503933)
AA seq 535 aa AA seqDB search
MEVAAMEISTSLLLTTVALSVIVCYALVFSRAGKARAPLPLPPGPRGWPVLGNLPQLGGK
THQTLHEMTKVYGPLIRLRFGSSDVVVAGSAPVAAQFLRTHDANFSSRPRNSGGEHMAYN
GRDVVFGPYGPRWRAMRKICAVNLFSARALDDLRAFREREAVLMVRSLAEASAAPGSSSP
AAVVLGKEVNVCTTNALSRAAVGRRVFAAGAGEGAREFKEIVLEVMEVGGVLNVGDFVPA
LRWLDPQGVVARMKKLHRRFDDMMNAIIAERRAGSLLKPTDSREEGKDLLGLLLAMVQEQ
EWLAAGEDDRITDTEIKALILNLFVAGTDTTSTIVEWTMAELIRHPDILKHAQEELDVVV
GRDRLLSESDLSHLTFFHAIIKETFRLHPSTPLSLPRMASEECEIAGYRIPKGAELLVNV
WGIARDPAIWPDPLEYKPSRFLPGGTHTDVDVKGNDFGLIPFGAGRRICAGLSWGLRMVT
MTAATLVHAFDWQLPADQTPDKLNMDEAFTLLLQRAEPLVVHPVPRLLPSAYNIA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgccgccatggagatctctacctcattgctcctcaccaccgtggctctctcc
gtcatcgtgtgctacgccctggtcttctcccgcgccgggaaggcgcgtgcgccgctgccg
ctgccgcctggccccaggggatggccggtgctgggcaacctgccgcagctgggcgggaag
acgcaccagacgctgcacgagatgaccaaggtgtacggcccgctgatccggctccggttc
gggagctccgacgtggtggtcgccggctcggcgccggtggcggcgcagttcctccgcacc
cacgatgccaacttcagcagccggccacgcaactccggcggcgagcacatggcgtacaac
ggccgggacgtcgtgttcgggccgtacgggccgcggtggcgcgccatgcggaagatttgc
gccgtcaacctcttctccgcgcgcgcgctcgacgacctgcgcgctttccgggagcgggag
gccgtgctgatggttaggtcgctggcggaggcgagcgccgcccctgggtcgtcgtctcca
gcggcggtggtcctgggaaaggaggtgaatgtctgcacgacgaacgcgctgtcgcgcgcc
gcggtcgggcgccgcgtgttcgccgccggcgcgggcgagggcgcgagggagttcaaagag
atcgtgctggaggtgatggaggtgggtggtgtgctgaacgtcggcgacttcgtgccggcg
ctccggtggctggacccgcagggcgtggtagcgaggatgaaaaagctgcaccgccggttc
gacgacatgatgaacgcgatcatcgcggagaggagggccggatcactactcaaaccaacc
gacagtcgtgaggaaggtaaggacttgcttggcttgctcctggctatggtgcaggagcag
gagtggctcgccgccggcgaggacgacaggatcaccgacacggaaatcaaggcccttatc
ctgaatctattcgtggcgggcacagacacaacatcaaccatagttgagtggacaatggca
gagctgattcgacacccagatatcctcaagcacgcccaagaggagctagatgttgttgtg
ggtcgtgataggctcctctcagagtcggatctatcacatctcaccttcttccatgctatc
atcaaggagacattccgtctacatccatcaacaccgctctcgctgccacgcatggcatct
gaggagtgtgagatcgcaggctaccgtatccccaagggtgcagagttgctggtcaatgtg
tgggggatcgcccgtgacccagccatatggcctgacccactagagtacaagccctctcgg
ttcctccccggtgggacgcacactgatgtggatgtcaagggaaatgatttcggacttata
ccattcggtgcagggcgaaggatatgcgccggcctcagttggggcctgcggatggtcacc
atgacagcggccacgctggtgcatgcattcgactggcagctaccagcggaccagacgcca
gacaagctcaatatggatgaggcgtttaccctcctgctgcaaagggcagagccattggtg
gttcacccggtaccaaggcttctcccatccgcttacaatattgcataa

DBGET integrated database retrieval system