KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0400100-01Help
Entry
Os10t0400100-01   CDS       T02163                                 

Gene name
Os10g0400100
Definition
(RAP-DB) Methionyl-tRNA synthetase, class Ia domain containing protein.
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00450  Selenocompound metabolism
dosa00970  Aminoacyl-tRNA biosynthesis
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Os10t0400100-01 (Os10g0400100)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Os10t0400100-01 (Os10g0400100)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dosa01007]
    Os10t0400100-01 (Os10g0400100)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dosa03016]
    Os10t0400100-01 (Os10g0400100)
Enzymes [BR:dosa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Os10t0400100-01 (Os10g0400100)
Amino acid related enzymes [BR:dosa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Os10t0400100-01 (Os10g0400100)
Transfer RNA biogenesis [BR:dosa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Os10t0400100-01 (Os10g0400100)
 Prokaryotic type
   Other AARSs
    Os10t0400100-01 (Os10g0400100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
RAP-DB: Os10t0400100-01
Position
chr10:join(13493006..13493262,13493678..13493831,13493965..13494118,13494205..13494437,13494532..13494675,13494820..13494910,13495102..13495206,13495316..13495432,13495617..13495735,13495843..13495908,13496005..13496133,13496223..13496366,13496448..13496552)
AA seq 605 aa AA seqDB search
MAAAKEAVVPVEGRRNVLVTSALPYVNNVPHLGNIIGCVLSADAFARYCRLRGHNVLYVC
GTDEYGTATETKAMEEGCSPREICDKYHAIHKEVYEWFDISFDIFGRTSSPQQTEVCQDI
FLKLLDNNWLSENTMQQLYCNSCQRFLADRLVEGYCPTEGCNYDSARGDQCEKCGKLLNS
TELVNPKCKVCGSTPCVRDTDHLFLELPLLREKLEKYIDETSLTGSWSQNAIHATNAWLK
EGLKPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYISITACYTPEWEKWWKNPENVE
LYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYESGKFSKTKGIGVFGNDA
KSTNIPPEVWRYYLLTNRPEASDTLFTWTDLQAKCNNELLNNLGNFINRVLSFIAKPEGT
GYGSVVPDSPDVDSHALTQSLAETVGKLIDQYIDAMDKVKIKQGLKIAMAISSEGNAYLQ
ESQFWKLYKQDPASCATVMKTSVGIVYLLACLLEPFMPTFSKDVLQQLNLSPEEHLSFCD
EKGEVEKAKRPWDLIPSGHRIGKPAPLFKGLENEAVKGLREKFAGSQAERKLRTQVAAQL
EATSI
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgaaggaggcggtggtgccggtggaggggcggaggaacgtgctggtgacg
agcgcgctgccgtacgtgaacaacgtgccgcacctggggaacatcatcggctgcgtgctc
tccgccgacgccttcgcgcgctactgccgcctccgggggcacaacgtgctctacgtctgc
ggcaccgacgagtacggcaccgccaccgagaccaaggccatggaggaaggctgctccccc
agggagatctgcgacaagtaccatgccatccacaaggaagtgtacgagtggttcgacatc
agcttcgacatcttcggtagaacatcgtcgccgcaacagaccgaggtctgccaagacatc
ttcctcaagctactggacaacaattggctgtcagagaacacaatgcagcagctttactgc
aattcatgccaaaggttcttggctgacaggcttgtggagggctactgccccacagaggga
tgcaactatgactctgccaggggtgaccaatgcgagaagtgtggaaaattgctgaattca
actgagctggttaatcccaagtgcaaggtttgcgggagcacgccttgtgtccgcgacacg
gatcacttgttcttggagctccctctgctgagggagaaacttgagaagtatatcgacgag
acttctttgactggatcatggagccaaaacgctattcatgcaacaaatgcttggttgaag
gaagggttgaagcctcgctgcattaccagggatctgaaatggggtgtgcctgtcccacat
gagaagtacaaagacaaggtgttctatgtctggtttgatgcaccaatcgggtacatctcc
attacggcgtgctacacgcctgagtgggagaaatggtggaagaatccagaaaatgttgaa
ttgtatcagttcatgggtaaagacaatgtcccattccatacggtcatgttcccctccaca
ctacttggaactggagaaaattggactctgatgaagacgattagtgtgacagagtatctc
aattatgaatcaggaaagttctccaaaacaaagggcattggagtgtttgggaatgatgca
aaatccacaaatattcctcctgaagtgtggcgatactacttgcttaccaatcgtcccgag
gcatcagatacattgttcacttggacagatttgcaagccaagtgtaacaacgagctgctg
aacaatttagggaacttcatcaatcgagtactaagctttatcgcgaaaccagagggaact
ggatatggttctgttgtacctgattctcctgatgtggattcccatgctctgactcagtca
ttggctgagactgttggtaaattgattgatcagtacatcgatgcaatggacaaggtcaaa
ataaaacaagggctgaagattgcaatggccatttctagcgaaggaaatgcatacctacaa
gagagtcagttttggaagctttacaaacaagatccagccagttgcgcaactgtgatgaaa
acctcagttggaattgtgtacctcctggcatgtttgctggagcctttcatgccaacattc
tcaaaagatgttctgcagcagctaaatctaagtccagaagagcacctatcattttgtgat
gaaaaaggagaggttgagaaggccaaaagaccttgggatctcataccatcaggccacagg
atagggaaacctgcacctttgttcaagggattggaaaacgaagcggtgaagggcttgaga
gaaaaatttgcaggcagccaagctgaaagaaaattgaggactcaagtcgccgcacaattg
gaagccacaagcatatag

DBGET integrated database retrieval system