KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0400500-00Help
Entry
Os10t0400500-00   CDS       T02163                                 

Gene name
Os10g0400500
Definition
(RAP-DB) Similar to Pyridoxal-dependent decarboxylase conserved domain containing protein, expressed.
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00350  Tyrosine metabolism
dosa00360  Phenylalanine metabolism
dosa00380  Tryptophan metabolism
dosa00950  Isoquinoline alkaloid biosynthesis
dosa00965  Betalain biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Os10t0400500-00 (Os10g0400500)
   00360 Phenylalanine metabolism
    Os10t0400500-00 (Os10g0400500)
   00380 Tryptophan metabolism
    Os10t0400500-00 (Os10g0400500)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    Os10t0400500-00 (Os10g0400500)
   00950 Isoquinoline alkaloid biosynthesis
    Os10t0400500-00 (Os10g0400500)
   00965 Betalain biosynthesis
    Os10t0400500-00 (Os10g0400500)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dosa04147]
    Os10t0400500-00 (Os10g0400500)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Os10t0400500-00 (Os10g0400500)
    4.1.1.105  L-tryptophan decarboxylase
     Os10t0400500-00 (Os10g0400500)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os10t0400500-00 (Os10g0400500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
RAP-DB: Os10t0400500-00
Position
chr10:complement(13524417..13525925)
AA seq 502 aa AA seqDB search
MGSLPLDALQPLDPDTFAADSSAVVDFLAGYYRDVDKYPVRAADLEPGRLRRLLPEAAPE
FGEPAERILADVRRDVLPGLTHWQSPSFFAYFPMNASAAGFAGEMLSVGLNVVPFMWVAS
PAAVELEAVVVDWMARLVGLPDRFLFSGSGGGGGGGGGGVLQGSTCEAVVCTLAAARDRA
LGRIGHEGIVKLVVYASDQTHATFQKGARLVGITPANFRVVPTAAASGYALTGAAVRAAV
EGDVARGLVPLYLCATVGTTGIGAVDPVRELGEVARRHGMWLHVDAAYAGSAAICPEYQG
YLDGAELADSVSMNPHKWFLTNMDCCCLWVASPAALTAALSTDPEYLKNAGGGKPQAAAG
AGAIDYKDWQISLSRRFRAMKLWFVLRRYGAAGMRAHIRRHVAMAEWFERAVSADERFEV
VAKRRFSLVCFRLRGGGGGGDAMNRELLAAVNASGRAFMTHFVVEGKFVIRLAVGGAMTE
MRHVGDAWELVQRTAEQLLQRR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcttgccactcgacgcgctccagccactggacccggacaccttcgccgccgac
tcctccgccgtcgtcgacttcctcgccggctactaccgcgacgtcgacaagtaccccgtc
cgcgccgccgacctcgagcctggccgcctccgcaggctcctcccggaggccgcgccggag
ttcggggagccggcggagcggatcctcgctgacgtgcgccgcgacgtgctcccggggctc
acgcactggcagagccccagcttcttcgcctacttcccgatgaacgccagcgccgccggg
ttcgccggcgagatgctctccgtggggctcaacgtcgtgccgttcatgtgggttgcgtcg
ccggctgccgtggagctggaggccgtcgtggtggactggatggctaggctggtgggcttg
cctgatcgcttcctcttctccggctccggcggcggcggcggcggcggtggcggtggtgtt
ctgcaggggagcacctgcgaggccgtggtgtgcacgctcgccgccgcgcgggaccgcgcg
ctggggaggattgggcacgagggcatcgtgaagctggtggtgtacgcctccgaccagacg
cacgccacgttccagaagggcgcgcggctggtcggcatcacgccggcgaacttccgcgtc
gtcccgacggcggcggcgtcggggtacgcgctgacgggcgccgccgtgcgcgccgcggtg
gagggcgacgtggcgcgcgggctggtcccgctgtacctgtgcgccactgtgggcaccacg
gggatcggcgccgtcgaccccgtccgcgagctcggcgaggtggcgcgccgccacggcatg
tggctccacgtcgacgccgcgtacgccggcagcgcggcgatctgcccggagtaccagggc
tacctcgacggcgccgagctcgccgactcggtgagcatgaacccgcacaagtggttcctc
accaacatggactgctgctgcctctgggtggcgagccccgccgcgctcaccgccgcgctg
tccaccgacccggagtacctcaagaacgccggcggcgggaagccccaggccgccgccggc
gccggcgccatcgactacaaggactggcagatctcgctgtcgcggcggttccgcgccatg
aagctctggttcgtgctgcggcggtacggcgctgcgggcatgcgcgcgcacatccggcgc
cacgtcgccatggccgagtggttcgagcgcgcggtgagcgccgacgagcggttcgaggtg
gtggcgaagaggaggttctccctcgtgtgcttccgcctccgcggcggcggcggcggcggc
gacgcgatgaaccgcgagctcctggcggcggtgaacgcgagcgggcgggcgttcatgacg
cacttcgtggtggagggcaagttcgtgatccggctcgccgtcggcggcgccatgacggag
atgaggcatgtcggcgacgcgtgggagctggtgcagcgcacggcggagcagctgctgcag
cgccggtag

DBGET integrated database retrieval system