KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0456900-01Help
Entry
Os10t0456900-01   CDS       T02163                                 

Gene name
Os10g0456900
Definition
(RAP-DB) Similar to Midasin.
  KO
K14572  midasin
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Os10t0456900-01 (Os10g0456900)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os10t0456900-01 (Os10g0456900)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Os10t0456900-01 (Os10g0456900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_CoxE VWA_2 Coq4 DUF58
Motif
Other DBs
RAP-DB: Os10t0456900-01
Position
chr10:complement(join(16711636..16712550,16711255..16711536,16710987..16711166,16710808..16710906,16710590..16710715,16710440..16710472))
AA seq 544 aa AA seqDB search
NNAEMDYNRESESNLANSTDMNSAAAPSVNFSSNEVPSLEISMPNSGDGSRLLSNSKPEL
QTDTPPSQIKQTNPFRSIGDAMADWKERAKVSADTQDHQPEAEHHIDDESATEFRYVPDS
EQSTSQALGNATADQINDDLQVKQSSMEDENRVQKEEHNTDRAPGDDHNLEVPHLQASQS
RTNKSENANNLEHREIQTDTYVQDSVQGETDETFGDFVSFKQPPADEKTVMRDDLANDRE
LSTPMEINITDVDMKGPIVDWKSVELTTMKLSQELAEQLRLVMEPTLASKLQGDYRTGKR
INMKKVIPYIASHFRRDKIWLRRTKPNKRNYQVVIAVDDSRSMSEGKCGKVAIEALVTVC
RAMSQLEVGQFAVASFGKKGNVKVLHDFDQVFNGEAGTNMISSLSFEQDNKLEDEPVADL
LMHLNTMLDTAVARSRTPSGQNPLQQLVLIISDGKFHEKENLKRCVRNVLNRKRMIAYVL
LDGHEESIMDSLEVSYQGTKLTMGKYMDSFPFPYYVMLKNIEALPRTLADLLRQWFELMQ
SANE
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
aataatgccgaaatggactataacagagaatctgaatcaaacttggctaacagcactgat
atgaacagtgctgctgctccttctgttaatttttcaagcaatgaagtccctagtctggaa
atatctatgcccaactctggggatggctctaggttattgtctaactctaagccagagttg
cagactgatactccaccatcgcagatcaaacagacaaatccttttaggagcattggagat
gcaatggcggactggaaagaacgggccaaagtctcagctgatacgcaggatcatcaacca
gaagctgaacaccatattgatgatgaaagtgctaccgaatttcgttatgtgccggacagt
gagcagagcacctctcaggcactgggtaatgcaacagctgatcaaatcaacgatgacctg
caagtcaaacagtcttccatggaggatgaaaaccgtgtgcaaaaagaggaacacaatact
gacagggcacctggagatgatcataatcttgaagtgccacatctgcaagcttcacaatca
cgtaccaacaaatctgaaaatgccaacaaccttgagcatagagagattcaaactgataca
tatgttcaggattcagttcaaggtgaaacagacgagacttttggagattttgtttcgttc
aaacaacctccagcagatgaaaaaacagttatgcgggatgatttagccaatgacagggag
ttgtctactccgatggaaatcaacatcactgatgtagatatgaaaggtcctattgttgac
tggaaaagtgttgagctcacaactatgaagttgtcccaagaacttgctgagcaattgcgc
cttgtcatggaaccaactcttgcaagtaagcttcaaggagattacagaactggaaagaga
ataaacatgaaaaaggttattccatatattgcaagtcatttccgcagggataagatatgg
ttgcgccgaactaaacctaataaacgtaattaccaagtggttattgctgtggacgactca
cggagtatgtccgagggcaagtgtggaaaagtggctattgaagcattagttacagtctgc
cgggccatgtcacaacttgaggttggacagtttgcagttgcaagtttcgggaaaaaggga
aatgtcaaagtgctacatgatttcgatcaggtcttcaatggagaagcaggaacgaatatg
atttctagtttgtcctttgagcaagacaacaaacttgaggatgaaccagttgctgatctc
ttgatgcatctgaacacaatgcttgatactgccgtggcacggtcacgtacaccgtcaggg
caaaatccacttcagcaactcgtactaataatatctgacgggaagttccacgaaaaggaa
aatttgaagcgttgcgtcaggaatgtccttaacagaaagaggatgatcgcatatgtgctc
ctagatggtcacgaggaatctatcatggattcactggaagtatcctatcaaggtaccaaa
ctaaccatggggaaatatatggactcctttccattcccttactatgtcatgctgaagaat
attgaagcacttcctcgtacattggctgacttgcttagacagtggtttgagctcatgcag
agcgctaatgaatga

DBGET integrated database retrieval system