KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0521000-01
Entry
Os10t0521000-01   CDS       T02163                                 

Gene name
Os10g0521000, TRE1, TREHALASE_1
Definition
(RAP-DB) Similar to TRE1 protein (Fragment).
  KO
K01194  alpha,alpha-trehalase [EC:3.2.1.28]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os10t0521000-01 (Os10g0521000)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dosa00537]
    Os10t0521000-01 (Os10g0521000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     Os10t0521000-01 (Os10g0521000)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dosa00537]
 Enzymes
  Os10t0521000-01 (Os10g0521000)
SSDB
Motif
Pfam: Trehalase
Other DBs
RAP-DB: Os10t0521000-01
Position
chr10:complement(join(20158653..20159155,20157734..20157853,20157345..20157460,20157149..20157249,20156951..20157057,20156714..20156786,20156268..20156435,20156085..20156172,20155498..20155615,20155203..20155416,20154878..20154961))
AA seq 563 aa
MAPTAAVAGGGVEAEALLGLLQRVQSEALRAFGPNDFDPKLYVDLPLAADASAAAALASL
PRAAPSRGEMEAYISRYFALAGSDLVAAADPPDFERDPPGFLPRVERAEARAWALEVHAL
WKDLTRRVAPAVAARPDRHTLLPLPGRVVVPGSRFREVYYWDSYWVVRGLLVSKMYETAK
DIVLNLVYLVEKYGFVLNGARSYYTNRSQPPLLSSMVLDIYMATGDMAFVRRVFPSLLKE
HSFWMSEVHNVAVMDNHGRVHNLSRYQAMWNKPRPESATIDEEFASKLSTAAKEKFYHQV
ASTAETGWDFSSRWMRDSTDMTTLTTSCIIPVDLNTFILKMEQDIAFFAKLIGESTTSEI
FSEASKARHNAIDSVLWNADMEQWLDYWLPTDGNCQGVYQWKSISQNRAIFASNFVPLWL
NAQHSGLEQFVDEAKSVRVMRSLQKSGLLQPAGIATSLSNTGQQWDFPNGWAPLQHLIVE
GLLRSGSGEARELAEDIATRWVRTNYDAYKATGAMHEKYDVVTCGKSGGGGEYKPQTGFG
WSNGVILSFLDEFGWPQDKKIDC
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggcgcccaccgccgcggttgccgggggtggcgtggaggcggaggcgctgctggggctg
ctgcagcgggtgcagtcggaggcgctgcgggcgttcgggccgaacgacttcgaccccaag
ctctacgtcgacctgccgctcgccgccgacgccagcgcggcggccgcgctggcgtcgctg
ccgcgggcggcgccgtcgaggggcgagatggaggcctacatctcgaggtacttcgcgctg
gccgggtccgacctcgtcgccgccgccgacccgccggacttcgagcgcgacccccccggg
ttcctgcccagggtggagcgcgccgaggcgcgggcctgggcgctggaggtgcacgcgctg
tggaaggacctgacgcggcgggtggcgccggccgtcgcggcgcgccccgaccggcacacg
ctgctgccgctccccggcagggtggtcgtgccgggctccaggttccgggaggtctactac
tgggactcctactgggtcgtcagaggtttactggtgagcaaaatgtatgagacggcaaag
gatatcgtgcttaatcttgtgtatcttgttgagaaatatggttttgttctgaacggggca
agatcgtactacactaaccgaagccagccaccacttttaagctccatggttttagacata
tacatggcaactggtgatatggcttttgtgaggagggtatttccctcactgctgaaagag
catagtttctggatgtcagaggttcacaatgtggcagtaatggacaatcatggacgggta
cataatttgagtcgctaccaggctatgtggaacaaacctaggccagaaagtgcaacaatt
gatgaggaatttgcttcaaaactttctacggctgctaaagaaaaattctaccaccaagtt
gcttctacagctgaaacaggatgggattttagctctcgatggatgagggattctactgac
atgacaactctgacaacatcttgcataatacctgtggacttgaacacattcatattgaag
atggaacaggacatagctttctttgctaaactcattggagagagcacaacatcagaaata
ttttcagaggcttcaaaagcacgccataatgcaattgattctgttctgtggaacgctgac
atggagcaatggcttgactactggcttcctactgatggaaactgccagggagtctaccaa
tggaaatctatctcacagaaccgcgccatctttgcttctaattttgtacctttgtggtta
aatgctcaacattcaggcttggagcaatttgtcgatgaggcaaaatcagtgagagtcatg
agaagcctccagaaatcaggattactgcaacctgcaggaatcgcaacttccttatcaaac
acagggcaacaatgggattttccaaacggatgggccccgttgcagcatctgatagtcgag
ggattgttgaggtctggttcaggagaggcaagggaacttgctgaggacattgccacgagg
tgggtgagaacaaactatgatgcctataaggctaccggcgcgatgcatgagaagtacgat
gtggtgacctgtggaaaatctggaggtgggggtgaatacaaaccccagactggttttggt
tggtccaacggtgtgatattatcattcttggatgaatttggatggcctcaggacaagaag
atagactgctag

DBGET integrated database retrieval system