KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os10t0569400-01
Entry
Os10t0569400-01   CDS       T02163                                 

Gene name
Os10g0569400
Definition
(RAP-DB) RIR1a protein precursor.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Other DBs
RAP-DB: Os10t0569400-01
Position
chr10:join(22575251..22575377,22576067..22576263)
AA seq 107 aa
MMRKQSRSPCSSSSSAAVVSLCKVLLLVLALICTLETVSVEGGRVAAAALVGGGVPLNPR
YPAIPEEPYIGRRGDPYTGRGGEPYTRPGRGCTVAYGCYGGPPAAKP
NT seq 324 nt   +upstreamnt  +downstreamnt
atgatgaggaagcaaagccgctctccttgttcatcttcttcttctgctgctgttgtgtcc
ctctgcaaggtgctcctgttggtcctggctctcatctgcaccctggaaactgtctcagta
gaaggagggagagtggcagcagcagcattagttggtgggggcgtaccactgaatccacgg
tacccggcgattcctgaagaaccttacataggccggagaggcgatccgtacacaggtcgg
ggaggcgaaccttacacacgcccgggacggggatgcaccgttgcatacggatgctatgga
ggtcctccagctgccaaaccatga

DBGET integrated database retrieval system