KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0189600-01
Entry
Os11t0189600-01   CDS       T02163                                 

Gene name
Os11g0189600
Definition
(RAP-DB) Similar to Cycloartenol synthase.
  KO
K19010  parkeol synthase [EC:5.4.99.47]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    Os11t0189600-01 (Os11g0189600)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.47  parkeol synthase
     Os11t0189600-01 (Os11g0189600)
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement Pec_lyase Mago-bind
Other DBs
RAP-DB: Os11t0189600-01
Position
chr11:join(4522443..4522640,4523065..4523250,4526689..4526775,4527223..4527420,4527529..4527613,4528760..4528926,4532276..4532464,4545956..4546069,4547915..4548037,4548148..4548270,4550758..4550856,4550985..4551041,4551583..4551629,4551726..4551869,4551969..4552146,4554020..4554100,4554173..4554256,4557561..4557680)
AA seq 759 aa
MWRLKVSEGGSPWLRSVNNLLGRQVWEFDPDLGTPEERADVEKARREFAEHRFERKHSSD
LLMRMQFAKENCQKLDLLAVKRGEHEDVMGEAVWSSLKRAISRVCNLQAHDGHWPGDYAG
LMFFLPGLIITLHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHSTMLGSSLN
YVALRLLGEGPNGGDGCIENGRNWILDHGGATFTTSWGKFWLSVLGVFDWSGNNPVPPEL
LLLPYQLPFHPGRMSSYIRMVFIPMSYIYGKRFVGPVTPVVLELRSELYNDPYDEIDWNK
ARTQCAKEDMYYPRSSKLDMFWSFLHKFIEPVLLRWPGRKLREKALATSMRNVHYEDECT
RYICFGGVPKALNILACWIEDPSSEAFKCHIARVYDYLWIAEDGMKMQIYDGSQVWDAGL
TVEALVATDLVKELGPTLKRAHSFLKNSQLLDNCPRDFNRWYRHISKGGWTFTTADDGWQ
VSDCTATALKACLLLSRISPEIVGEPLEIDAQYDAVNCLMSLMNDNGGFSAFELVRSNTW
LEHINPTEAFGRVMIEYPYVECTSSSIQCLALFKKLHPGHRKEEVENCISKGANFIESSQ
RSDGSWYGSWGICFTYATWFAVTGLVSAGRTLGNSATVRKACDFLLSKQLPSGGWGESYL
SCHDEVYTNLKGNRPHGTHTAWAMIALIDAGQAERDPVPLHRAAKALLNLQLEDGEFPQQ
EIVGVFLQTAMISYSQYRNIFPIMALTGYRRRVLLAGNI
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtggaggctgaaggtgtcggagggcggcagcccatggctgcggtcggtaaacaatctc
ctcggccggcaagtgtgggagttcgaccctgacctcggcacgccagaggagcgcgccgat
gtggagaaggcgcgccgcgagttcgccgagcaccgcttcgagcgcaagcattctagcgac
ctcctcatgcggatgcagttcgctaaagaaaactgtcaaaagctggaccttctcgctgtc
aagcgtggagagcacgaagacgtcatgggggaagctgtgtggagctctttgaaacgggcc
ataagccgcgtttgtaatttgcaggcacatgatggacactggcccggggattatgcagga
cttatgttctttttgcctggcttgattataacattgcatgtcagtggagttctgaacact
gttttatcatcggaacatcagaaggagatgcgccggtacatctataatcaccagaatgaa
gatggagggtgggggttgcacattgagggccacagcaccatgcttggctcatccctgaac
tatgttgctttgagattgcttggggagggtccaaatggtggagatggatgcatagagaat
ggtcgaaactggattttagatcatggaggagccacatttacgacatcatgggggaagttc
tggctctcggtacttggagtatttgattggtccggtaataacccagtgccaccagagtta
ttactattgccgtatcaactgccgtttcacccaggtcgaatgtcgagctatatccgaatg
gtgtttatacccatgtcttacatttatggaaaaaggtttgttggcccagtaacaccagtt
gtgctagagctaagaagtgaactatacaatgacccctatgatgagattgactggaacaaa
gctcgtactcagtgtgcaaaggaagatatgtactatccacgttcatccaaactggatatg
ttttggtcctttctccacaagtttattgaaccagttttgttgcgctggcctgggagaaaa
ctgagggagaaagctctggccacttccatgaggaatgttcactatgaagatgagtgcact
cgatacatctgtttcggtggtgtacccaaggcattaaatatccttgcttgctggattgaa
gatccaagctcagaggcattcaaatgccatattgcacgcgtatatgattatttatggatc
gctgaagacggcatgaagatgcagatttacgatggcagccaggtgtgggacgcaggtttg
acagttgaggcccttgtggctactgaccttgtcaaagagcttggaccaactcttaaacga
gcgcattccttccttaagaattcgcagttgcttgacaattgcccccgagatttcaaccgc
tggtatcgccatatatccaaaggtggatggacatttacaacagctgatgatggctggcaa
gtttcagattgcacggcgacagcactgaaggcatgtctattgttatcaaggatatctcct
gaaatcgttggtgaaccactggaaattgatgcacaatacgatgctgttaattgtctgatg
tctttgatgaatgataatggtggcttttcagcatttgaactcgtaaggtctaatacatgg
ctggagcatattaatcctacagaggcatttgggcgtgtaatgattgaatatccgtatgtc
gaatgtacatcatcatcaattcagtgtctagcattattcaaaaaacttcacccagggcac
cgcaaggaagaggtggaaaattgtatcagcaaaggtgctaatttcattgagagttctcag
agaagcgatggttcatggtatggttcttgggggatttgtttcacctatgccacatggttt
gcagtgacaggattagtttctgcaggcaggacacttgggaatagcgctacagttagaaag
gcatgtgactttctcttgtcaaaacagcttccttcgggtggctggggcgagagctatttg
tcatgtcatgacgaggtttacacaaatcttaaaggcaaccgacctcacggtacgcacact
gcgtgggccatgattgcactaattgatgcagggcaggctgaaagagatccagtgcctctg
catcgagcagccaaggctttgctcaacttgcaattagaggatggagaatttccacagcaa
gaaattgttggagtctttctccaaactgccatgatcagttattcccagtacaggaacatc
ttccctataatggctctcacagggtatcgccgccgagtactgcttgcaggcaacatatag

DBGET integrated database retrieval system