KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0264300-01
Entry
Os11t0264300-01   CDS       T02163                                 

Gene name
Os11g0264300
Definition
(RAP-DB) Similar to RWP-RK domain containing protein, expressed.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: GAF
Position
chr11:complement(join(8976315..8977112,8975635..8975676))
AA seq 279 aa
MDGGGTPDGDPVPDMDMLMLSSALDGLDSYTDLVAGSSVADSIFSALTCFPPSQERLLHV
STPVGSNSRQDDSDVSITKEGTTTRRGDCAAGLASGEPVAAGIGSVPKPFDGVTLTERML
RALAMLKEASGGEAILVQVWMPVRNGEQHVLTTSDQPFLLDQKLTGYREVSRQFTFSAEE
GPGLFPGLPGRVFMSGMPEWTSNVMYYHGSEYLRVDYARRHEVRGSLAMPVFNSSGGSCC
AVLEVVMTREKDNFCLEMVNVSNALQGTHDLNTQHRKND
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatggaggtgggacgccggatggggatccggtgccggacatggacatgctcatgctg
tcatcagcgctcgatggcctcgacagctacaccgacctcgtcgcgggttcatcggtagcc
gacagcatcttctcagctcttacctgtttcccaccatcacaagaacgattgctgcacgtc
tcgactcctgtgggttctaattctaggcaagatgattctgatgtttccatcactaaggag
ggtacaacaacaagaagaggtgattgcgccgccggattagcttcaggtgagccggtggcc
gcgggaattggctctgtcccgaagccgttcgacggcgtcacactgacggagaggatgctc
agggcgcttgcgatgctcaaagaggcgtcgggtggcgaagcgatccttgtgcaggtctgg
atgcctgtgaggaatggggagcagcatgtgctgactacctctgaccagccgttcttgctc
gatcagaagcttacgggatacagggaagtctccaggcagttcacattctcggctgaagaa
ggacccggtctgttccccggattgcccggccgggttttcatgtccggcatgccagagtgg
acgtcgaatgtgatgtactatcatggctcggagtatttgagggttgattatgctaggcgc
cacgaggtccgtggatcccttgcgatgccggttttcaactcaagtggtgggtcttgctgt
gcagtgttagaagtagtaatgacacgagagaaggataacttttgcttagagatggtcaat
gtttcgaatgctctgcagggcacacatgacttgaacacacagcacagaaagaatgactaa

DBGET integrated database retrieval system