KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os11t0539200-01
Entry
Os11t0539200-01   CDS       T02163                                 

Gene name
Os11g0539200
Definition
(RAP-DB) Similar to Xyloglucan endotransglycosylase XET2 (Fragment).
  KO
K08235  xyloglucan:xyloglucosyl transferase [EC:2.4.1.207]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Os11t0539200-01 (Os11g0539200)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.207  xyloglucan:xyloglucosyl transferase
     Os11t0539200-01 (Os11g0539200)
SSDB
Motif
Pfam: Glyco_hydro_16 XET_C
Other DBs
RAP-DB: Os11t0539200-01
Position
chr11:join(19675037..19675330,19675426..19675619,19677354..19677753)
AA seq 295 aa
MATTTAAAMVVAMSVLLLGGGEAAAPRKPVDVAFEKNYVPTWAEDHIHYVDGGREVQLYL
DKSTGTGFQTRGSYLFGHFSMHIKLVAGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGE
PYILQTNVFSGGKGDREQRIYLWFDPTKDYHSYSVLWNLYMIAFFVDDTPIRVFKNSKDL
GVRYPFNQPMKLYSSLWNADDWATRGGREKTDWSRAPFVASYRGFHVDGCEASAEARYCA
TQGARWWDQPEFRDLDADQYRRLAWVRKTHTIYNYCDDRERYPAMSPECHRDRDA
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcgacgacgacggcggcggcgatggtggtggcaatgtcggtgctgctgctgggtggc
ggcgaggcggcggcgccgcggaagccggtggacgtggcgttcgagaagaactacgtgccg
acgtgggcggaggaccacatccactacgtggacggcgggcgcgaggtgcagctctacctc
gacaagtccaccggcaccggcttccagacccggggctcctacctcttcggccacttcagc
atgcacatcaagctcgtcgccggcgactccgccggcaccgtcaccgccttctacctgtcg
tcgcagaactcggagcacgacgagatcgacttcgagttcctggggaacaggacgggggag
ccgtacatcctgcagacgaacgtcttctccggcgggaagggggaccgggagcagaggatc
tacctctggttcgaccccaccaaggactaccactcctactccgtcctctggaacctctac
atgatcgcgttcttcgtggacgacacgccgatcagggtgttcaagaacagcaaggacctg
ggcgtgcggtacccgttcaaccagccgatgaagctctactccagcctgtggaacgccgac
gactgggccacccgcggcgggcgggagaagaccgactggtcgcgggcgccgttcgtcgcc
tcctaccggggcttccacgtcgatggctgcgaggcgtcggcggaggcccggtactgcgcc
acccagggcgcccggtggtgggaccagccggagttccgcgacctcgacgccgaccagtac
cgccgcctcgcctgggtccgcaagacgcacaccatctacaactactgcgacgaccgcgaa
cgctaccccgccatgtcgcccgagtgccaccgcgaccgcgacgcctga

DBGET integrated database retrieval system