KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os12t0114500-01
Entry
Os12t0114500-01   CDS       T02163                                 

Gene name
Os12g0114500
Definition
(RAP-DB) Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Tryp_alpha_amyl LTP_2 SAVED
Other DBs
RAP-DB: Os12t0114500-01
Position
chr12:join(723381..723730,723864..723873)
AA seq 119 aa
MARAANNKYVAAVMVVALLLAAPAASAVTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVR
TLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRVH
NT seq 360 nt   +upstreamnt  +downstreamnt
atggctcgcgcggcgaataataagtatgtggcggcggtgatggtggtggcgctgctgttg
gcggcgccggcggcgagcgcggtgacatgcgggcaggtggtgagcatgctggcgccgtgc
atcatgtacgcgacggggagggtgtccgcccccaccggcggctgctgcgacggggtcagg
accctcaactccgccgccgccaccaccgccgaccgccagaccacctgcgcctgcctcaag
cagcagaccagcgccatgggcggcctgaggcccgacctcgtcgccggcatcccctccaag
tgcggcgtcaacatcccctacgctatcagcccttccaccgactgctccagggtgcactga

DBGET integrated database retrieval system